Leaning tower of pisa factsJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 leaning tower of pisa facts jobs fundet

    In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...

    €41 Average bid
    €41 Gns Bud
    12 bud

    The creation of a virtual office

    €160 Average bid
    €160 Gns Bud
    4 bud

    ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish

    €197 Average bid
    €197 Gns Bud
    4 bud

    Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid

    €149 Average bid
    €149 Gns Bud
    5 bud

    Logo designing

    €73 Average bid
    €73 Gns Bud
    21 bud
    €12 / hr Gns Bud
    4 bud
    Build of models
    Udløbet left

    Autocad designing

    €274 Average bid
    €274 Gns Bud
    6 bud

    COPY OF AN ECOMMERCE SITE NEED My budget 30 usd

    €28 Average bid
    €28 Gns Bud
    2 bud

    Design A Catalog Of Products (1 Page)

    €18 Average bid
    €18 Gns Bud
    12 bud
    €29 - €29
    0 bud

    /findtranscript/ error.. pls fix

    PHP
    €19 Average bid
    €19 Gns Bud
    17 bud

    poster for online posts 3 pictures Bold

    €21 Average bid
    €21 Gns Bud
    13 bud

    Vi søger en dansk skribent (Ghostwriter) til at skrive artikler (1000 ord) til et dansk blog medie. Bloggen henvender sig til danske iværksættere og vækstvirksomheder. Din opgave er at omdanne vores input til professionelle og spændende artikler. Vi levere en “synops” på hver artikel, med synspunkter, meninger og facts, som du omdanner til en færdig artikel. Vi leder efter en person som er; - Indfødt dansker, som skriver perfekt fejlfrit på dansk - Føler sig hjemmevandt indenfor iværksætteri og vækstbrancher - Er interesseret i at skrive løbende for os (antal artikler kan vi aftale) Buddet er for 1 artikel (test artikel) 1000 ord på dansk. Send eksempler p&arin...

    €20 Average bid
    €20 Gns Bud
    1 bud

    Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

    €148 - €445
    €148 - €445
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €148
    €18 - €148
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud

    Tunne a linux server

    €146 - €146
    €146 - €146
    0 bud

    im looking for an estimate on creating a cad drawing of the ring that i uploaded

    €29 - €244
    €29 - €244
    0 bud

    As per skype conference

    €439 Average bid
    €439 Gns Bud
    1 bud

    Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...

    €390 Average bid
    €390 Gns Bud
    5 bud

    I'm looking for someone with a knack for writing and storytelling. The project is somewhat ambiguous at the moment, but it definitely leans towards creative writing. Ideal Skills: - Excellent command of the English language - Strong storytelling ability - Creative thinking Experience: - Previous work in writing and storytelling - Experience in crafting fiction will be a plus Please note that the type of writing needed may be primarily creative and artistic in nature.

    €731 Average bid
    €731 Gns Bud
    3 bud

    I'm looking for an engaging PowerPoint presentation in Arabic language about canary birds. The target audience is my 7 year old daughter. Key Requirements: - The main focus should be interesting facts about canaries. - The presentation should be in PowerPoint format. - It should include images and photos of canary birds. Ideal Skills: - Experience in creating PowerPoint presentations - Understanding of how to present information to young children - Knowledge of canary birds - Graphic design skills to source and include appropriate images.

    €81 Average bid
    €81 Gns Bud
    95 bud

    More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Detailed project proposals How soon do you need your project completed? Within a month

    €30 Average bid
    €30 Gns Bud
    21 bud

    Important : Kindly bid if and only if you are willing to take a test assignment. We are looking for a skilled and experienced Figma designer to convert 20 pages of JPG website designs into a fully responsive Figma project. The designs need to be pixel-perfect and optimized for Desktop, Mobile, and Tablet screen sizes. Project Requirements: 1. Figma Expertise: • Convert 20 JPG design files into Figma accurately, maintaining pixel-perfect alignment with the original designs. 2. Responsive Design: • Create layouts optimized for Desktop, Tablet, and Mobile views. • Ensure the designs are fully responsive and adaptable to different screen sizes. 3. Consistency: • Use Figma’s components, auto-layouts, and styles to maintain consistency across the project...

    €99 Average bid
    €99 Gns Bud
    18 bud

    I'm seeking a talented designer to create a modern an...seeking a talented designer to create a modern and sleek t-shirt design for my Army strategic intelligence unit. The design should be able to reflect our mission of supporting service members globally, and it should include the following key elements: - Our unit emblem or insignia - A globe or world map - Depictions of service members Color-wise, I'm leaning towards a bold and vibrant color scheme. The ideal candidate for this project should have experience in graphic design, particularly with creating designs suitable for t-shirts. Understanding of military themes and aesthetics would be a plus. Please ensure the design is oni of high pixel quality, as it will be used for printing on shi...

    €119 Average bid
    €119 Gns Bud
    83 bud

    I'm in need of a high-precision 3D scan of a small plastic object, roughly 2 inches or less. The primary purpose of this scan is for 3D printing, so the model needs to be as accurate as possible. Ideal Skills: - Proficient in 3D scanning technology - Experience in creating models for 3D printing - Attention to detail for high-precision tasks

    €72 Average bid
    €72 Gns Bud
    49 bud

    You have a pre-built java vaadin saas platform? I'm looking for an experienced developer who can work with a pre-built Java Vaadin SaaS platform. The key tasks will involve extending the platform to meet our specific requirements, as well as incorporating our branding g...pre-built java vaadin saas platform? I'm looking for an experienced developer who can work with a pre-built Java Vaadin SaaS platform. The key tasks will involve extending the platform to meet our specific requirements, as well as incorporating our branding guidelines into the design. Ideal Skills: - Proficiency in Java and Vaadin - Experience with SaaS platform development - Strong understanding of UI/UX, with the ability to adapt to branding guidelines - Prior experience with platform customization a...

    €2461 Average bid
    €2461 Gns Bud
    69 bud

    This project delves into the fascinating intersection of behavioral finance and data science. We aim to analyze ptivided data through the lens of investor psychology, identifying behavioral biases and sentiment drivers that influence market trends. Using R and statistical modeling, we will examine historical market data, news sentiment, and social media trends to develop predictive models of market movements. This project offers a unique opportunity to contribute to a cutting-edge research initiative with real-world applications in investment strategy and risk management. Key Deliverables: Quantitative analysis of market data and investor behavior. Development of predictive models incorporating behavioral finance insights. Comprehensive report with data...

    €228 Average bid
    €228 Gns Bud
    19 bud

    I'm seeking a minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and...minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and vivid, so it should pop and be visually engaging. Key Requirements: - Animation should have a minimalist design - Use of a bright and vivid color palette - Customization of the poker chips with my provided logo in the middle area Ideal Skills and Experience: - Proficient in creating WebM animations - Strong understanding of minimalist design principles - Experience with logo and patte...

    €99 Average bid
    €99 Gns Bud
    17 bud

    My Digital Ocean droplet, which hosts a web application, has stopped responding after a restart. I suspect a network issue. It’s crucial to get this fixed ASAP. Ideal Skills: - Experience with Digital Ocean droplets - Networking troubleshooting - Web application hosting - Server management Please reach out if you can assist. Bid if you can start working immediately

    €24 Average bid
    €24 Gns Bud
    17 bud

    ...AI-based early detection of congenital heart defects (CHDs) using a 12,000-labeled echocardiogram dataset. I need an experienced freelancer to completely build and train models using Convolutional Neural Networks (CNNs) and Generative Adversarial Networks (GANs) to achieve accurate and reliable results. The task involves: Preprocessing: Augmentation and cleaning of the dataset. Model Development: Building and training a GAN-CNN hybrid model for CHD detection. Validation: Testing and validating the model to generate results, including metrics like accuracy, sensitivity, and specificity. Deliverables: Fully functional code (Python/TensorFlow/Keras, Google Colab preferred). Final results and visualizations (accuracy metrics, confusion matrix, etc.). Proper documentation ...

    €34 / hr Average bid
    €34 / hr Gns Bud
    72 bud

    I want to develop an animated series which concentrates on "how to make India a developed country". Trailer: In 1700 India was holding 27% of world economy. 200 years later India's share dropped to less than 3%. Why? Because British came and demolished India's native institutions. 1) Its economy deindustrialized 2) Its trade networks got destroyed 3) Its people got deeply divided by caste and creed. In just 200years India was turned from richest country to developing country. It is 21st century, still we are said as a developing country. Here comes KALAM who tells us in each episode one idea how to turn India to a developed country. Hold on to watch more ..................trailer ends I need someone to help me with the script for this trailer.

    €11 / hr Average bid
    €11 / hr Gns Bud
    7 bud

    I am seeking a talented creative writer with a knack for crafting captivating romance narratives. Your primary task will be to create engaging storylines that resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narrati...resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narratives. - Ability to understand and cater to an adult audience. Your creative storytelling will not only entertain but also draw readers into the beautiful complexities of...

    €19 / hr Average bid
    €19 / hr Gns Bud
    14 bud

    I am in need of a talented copywriter who can help me craft compelling product descriptions aimed at increasing sales. The target audience for these descriptions is the general consumer market, so the copy will need to be accessible, engaging, and persuasive to a wide array of potential customers. Ideal Skills and Experience: - Proven experience in copywriting, particularly in crafting product descriptions - Strong understanding of sales-oriented copy - Ability to write for a general consumer audience - Creativity and ability to think outside the box - Excellent command of the English language

    €251 Average bid
    €251 Gns Bud
    27 bud

    To discuss scope, deliverable of project.

    €12 Average bid
    €12 Gns Bud
    1 bud

    I need a professional 3D Blender expert who can bake an entire house for me. I have existing 3D models of the house, so there's no need to create new ones from scratch. Key requirements: - 3D baking of the house's entire structure: exterior walls, roof, and interior rooms - Applying low-detail, basic textures to the models Ideal skills and experience: - Proficiency in 3D Blender - Previous experience in 3D modelling and texture baking - Attention to detail while applying basic textures

    €16 Average bid
    €16 Gns Bud
    6 bud

    Hello Nick! Thank you for the project invitations. There are some documentation that Raras has been requested. The scopes are: 1. User Journey of my Past Project about End-to-End & Supplier apps. 2. It includes user flow, screen, cta, and description. 3. The details will be how the master data are build, how purchase order and request are submitted, and how the goods are received and updated in to the apps

    €5 / hr Average bid
    €5 / hr Gns Bud
    1 bud

    after the market opening of the day or week or month , indicator will identify the setup candle in a smaller time frame based on my spec and draw horizontal lines on HL that will stay for the rest of the day, week, month.

    €47 Average bid
    €47 Gns Bud
    3 bud

    ...editorial skills for creating compelling articles and stories. - Excellent eye for design and detail for selecting appropriate visuals. - Familiarity with both print and digital publishing processes. - Understanding of the Italian culture and language to ensure content is relevant and engaging. I'm looking for a freelancer who can bring creativity, professionalism, and a deep understanding of magazine publishing to this project. Given I have just returned from Italy and visited all of the below regions, I would also like to capture my experience and add web page links for each of the regions I have stipulated below. The magazine to include a food/fashion experience for the reader and everything cultural for each region. Magazine to pertain to the be...

    €207 Average bid
    €207 Gns Bud
    51 bud

    I'm in need of a music artist or band to re-record 'Kick' by INXS. Key Requirements: - The re-recorded song should fit the same style and genre as the original INXS track. - New lyrics need to be created to avoid copyright issues, but they should maintain the same lyrical theme and subject as the original song. - Additional production elements such as background vocals, instrumental solos, and sound effects are welcomed, but not mandatory. The final decision can be up to your creative expertise. Ideal Skills and Experience: - Prior experience in music production and songwriting. - Ability to replicate the rock style of INXS. - Creativity in composing catchy, relevant new lyrics. - Experience in adding diverse production elements to enhance the track. I nee...

    €14 Average bid
    €14 Gns Bud
    6 bud

    I'm looking for a skilled 3D artist to create a realistic 3D render of ski goggles for marketing material. The render should be from a front view angle. Ideal Skills: - Proficiency in 3D modeling software (e.g., Blender, Maya, 3ds Max) - Strong understanding of realistic texturing and lighting - Experience in creating 3D visuals for marketing purposes Please provide examples of similar work you've done in the past.

    €917 Average bid
    €917 Gns Bud
    23 bud

    The city I live in got hammered with over a foot of snow and ice earlier this week. There are huge piles all around the neighborhood where they were plowed up by trucks treating the road. The joke is that the piles are never going to melt. I found two decent photos from the front of my house during a warmer time. They are attached. I'd like to have a large pile of snow and ice placed somewhere between the sidewalk and the street, near the mailbox. I'll post it on social media for smiles and laughs. Thank you!

    €10 Average bid
    Garanteret
    €10
    15 indlæg

    More details: What is the primary purpose of the recording? Personal memory What level of background noise reduction do you prefer? Heavy reduction (almost no noise) Are there specific segments of the conversation that are critical to hear clearly? Yes, specific parts are critical

    €89 Average bid
    €89 Gns Bud
    21 bud