Kansas department of transportationJobs
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm looking for an expert in Burp Suite to assist with a betting project that involves opening multiple tabs for simultaneous monitoring. The primary focus is to analyze betting odds and optimize strategies, while also identifying issues related to bet rejection. Key Tasks: - Multi-tab setup for Burp Suite to facilitate real-time betting data analysis. - Identification and troubleshooting of issues impacting the betting process, particularly bet rejections. Ideal Skills and Experience: - Proficiency with Burp Suite for automated testing and user session simulation. - Strong background in betting odds analysis and strategy optimization. - Experience in troubleshooting system glitches during betting sessions. Your expertise will help me understand the betting landscape bette...
I need an experienced creator for a 5-minute 4K 3D animation video of the Airbus A350. This video should include scenes of passenger boarding, takeoff, and landing. Key Requirements: - High level of detail and accurate engineering representation. - Inclusion of a modern/contemporary background score. - Seamless integration of sound effects and a professional voiceover. Deliverables: - A 5-minute 4K video. - Source files. - A draft for review. - Step-by-step documentation of the generative AI process used. Ideal Skills: - Proficient in 3D engineering animation. - Strong understanding of the Airbus A350. - Excellent audio-visual integration skills. - Experience with creating detailed source files and documentation.
I'm looking for a modern and sleek logo for my website, , which offers special transportation services. Key Requirements: - A modern and sleek design style - A blue and white color scheme - Inclusion of vehicle imagery in the logo Ideal Skills and Experience: - Proven experience in logo design - Strong understanding of modern and sleek design aesthetics - Ability to incorporate specific imagery into design The selected freelancer will be tasked with delivering a high-quality, professional logo that captures the essence of my brand. I you draw a car draw it like in the attached image
I'm looking for a talented artist who can create a cartoonish style oil painting of a symbolic grocery store. This portrait will be a special gift, so the artist should have a good understanding of creating a piece that is both unique and appealing. The address is 455 Bd Greber in Gatineau, Quebec (see image for inspiration). Key aspects of the project include: - The painting should capture the storefront exterior of the grocery store in a whimsical, cartoonish style. - The artist should have experience with oil painting, as this is the preferred medium for the portrait. - The final piece should be of high quality, suitable for gifting. Ideal skills and experience: - A strong portfolio of cartoonish oil paintings - Experience with creating s...
Will create Logo Tōtaranui Tri Summer of 25-26 as we discussed
I'm in need of a modern sticker design featuring a coat of arms with a caduceus. The design should include our company logo and two slogans: the Latin phrase 'In Tela Fidem Habemus' and the English equivalent 'In Gauze We Trust'. These phrases should encircle the coat of arms, with the Latin on top and the English underneath. Key design specifications: - The sticker is a circle with a diameter of 2.5". - The primary color scheme is red, white, and black. - The overall feel of the sticker should be fun and bright. -Our company logo should be incorporated (see attached file) Preferred design elements: - The coat of arms should be in a modern style. - The font for the slogans should be in a script style. Ideal candida...
I'm in need of a physical scale model of a fire department tanker truck. This model should be made of metal and designed with a basic exterior structure.
I'm seeking an expert to analyze the impact of Gaussian measurement noise on the accuracy of estimating parameters from a second order equivalent circuit model. The primary focus will be on estimating resistance and capacitance. Key components of the project: - Assess the influence of Gaussian noise on model parameter estimation. - Explore the efficacy of the Kalman filter in mitigating the effects of this noise. Ideal candidates will have: - Strong background in circuit modeling. - Proficiency in noise analysis and filtering techniques, especially the Kalman filter. - Experience with parameter estimation of circuit components.
I'm looking for a highly organized and efficient secretary to assist with organizing our department's work. This role will involve arranging meetings, writing internal communications, and coordinating teams and their schedules. The ideal candidate will have: ...involve arranging meetings, writing internal communications, and coordinating teams and their schedules. The ideal candidate will have: - Proficiency in Excel, Word, and PowerPoint - Excellent typing and reading skills in both Arabic and English - Preferably, a background in medical terminology and experience as a medical secretary Your main tasks will be to ensure the smooth operation of our department, facilitating communication and coordination. If you have the required skills and experience, I look for...
...Create descriptive and meaningful file names with a minimum of two words (preferably more, if it enhances clarity). - Use underscores (_) instead of spaces in file names (e.g., ). - Retain the original file name and append the new name to it (e.g., becomes ). - Focus on conveying the concept or meaning of the image rather than describing it literally. For example, an image of a person holding a flag on a mountain should reflect themes like "achievement," "success," or "leadership," rather than "man_with_flag_on_mountain." - Have at least a basic understanding of IT terminology, as many images are related to IT concepts. Requirements: - A good knowledge of English. - A creative mindset with the abil...
More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Detailed project proposals How soon do you need your project completed? Within a month
App Concept: Travel Together A mobile application connecting like-minded travelers through curated social events, short trips, and group activities. The app creates a vibrant community of explorers while ensuring safety, compatibility, and seamless travel planning. Key Features 1. User Profiles Travel Preferences: Specify travel interests like adventure, leisure, or cultural trips. Detailed Profiles: Add hobbies, personality traits, and travel styles. Safety Verification: Identity verification badges for trust and authenticity. 2. Event Discovery Curated Events: Browse or create short trips, city tours, hiking adventures, and more. Advanced Filters: Search by location, trip duration, type, and budget. Dynamic Calendar: View upcoming events and RSVP easily. 3. Companion Matching A...
Important : Kindly bid if and only if you are willing to take a test assignment. We are looking for a skilled and experienced Figma designer to convert 20 pages of JPG website designs into a fully responsive Figma project. The designs need to be pixel-perfect and optimized for Desktop, Mobile, and Tablet screen sizes. Project Requirements: 1. Figma Expertise: • Convert 20 JPG design files into Figma accurately, maintaining pixel-perfect alignment with the original designs. 2. Responsive Design: • Create layouts optimized for Desktop, Tablet, and Mobile views. • Ensure the designs are fully responsive and adaptable to different screen sizes. 3. Consistency: • Use Figma’s components, auto-layouts, and styles to maintain consistency across the project...
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
I'm in need of a high-precision 3D scan of a small plastic object, roughly 2 inches or less. The primary purpose of this scan is for 3D printing, so the model needs to be as accurate as possible. Ideal Skills: - Proficient in 3D scanning technology - Experience in creating models for 3D printing - Attention to detail for high-precision tasks
You have a pre-built java vaadin saas platform? I'm looking for an experienced developer who can work with a pre-built Java Vaadin SaaS platform. The key tasks will involve extending the platform to meet our specific requirements, as well as incorporating our branding g...pre-built java vaadin saas platform? I'm looking for an experienced developer who can work with a pre-built Java Vaadin SaaS platform. The key tasks will involve extending the platform to meet our specific requirements, as well as incorporating our branding guidelines into the design. Ideal Skills: - Proficiency in Java and Vaadin - Experience with SaaS platform development - Strong understanding of UI/UX, with the ability to adapt to branding guidelines - Prior experience with platform customization a...
This project delves into the fascinating intersection of behavioral finance and data science. We aim to analyze ptivided data through the lens of investor psychology, identifying behavioral biases and sentiment drivers that influence market trends. Using R and statistical modeling, we will examine historical market data, news sentiment, and social media trends to develop predictive models of market movements. This project offers a unique opportunity to contribute to a cutting-edge research initiative with real-world applications in investment strategy and risk management. Key Deliverables: Quantitative analysis of market data and investor behavior. Development of predictive models incorporating behavioral finance insights. Comprehensive report with data...
I'm seeking a minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and...minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and vivid, so it should pop and be visually engaging. Key Requirements: - Animation should have a minimalist design - Use of a bright and vivid color palette - Customization of the poker chips with my provided logo in the middle area Ideal Skills and Experience: - Proficient in creating WebM animations - Strong understanding of minimalist design principles - Experience with logo and patte...
My Digital Ocean droplet, which hosts a web application, has stopped responding after a restart. I suspect a network issue. It’s crucial to get this fixed ASAP. Ideal Skills: - Experience with Digital Ocean droplets - Networking troubleshooting - Web application hosting - Server management Please reach out if you can assist. Bid if you can start working immediately
...AI-based early detection of congenital heart defects (CHDs) using a 12,000-labeled echocardiogram dataset. I need an experienced freelancer to completely build and train models using Convolutional Neural Networks (CNNs) and Generative Adversarial Networks (GANs) to achieve accurate and reliable results. The task involves: Preprocessing: Augmentation and cleaning of the dataset. Model Development: Building and training a GAN-CNN hybrid model for CHD detection. Validation: Testing and validating the model to generate results, including metrics like accuracy, sensitivity, and specificity. Deliverables: Fully functional code (Python/TensorFlow/Keras, Google Colab preferred). Final results and visualizations (accuracy metrics, confusion matrix, etc.). Proper documentation ...
...integrations, and user-friendly interfaces. Scope of Work: We need a fully functional, scalable, and responsive airport transfer booking plugin that can handle the following: Key Features & Requirements Search & Booking System: A user-friendly search bar where users can input pickup and drop-off locations, travel dates, and passenger details. Auto-suggestions for airport names, cities, and landmarks with dynamic filtering. Display of available transfer options with details like vehicle type, capacity, price, and estimated travel time. Dynamic Pricing System with Tiered Pricing: Base pricing models based on distance, vehicle type, number of passengers, and luggage. Tiered pricing: Flexible pricing based on specific ranges or "tiers" of di...
I want to develop an animated series which concentrates on "how to make India a developed country". Trailer: In 1700 India was holding 27% of world economy. 200 years later India's share dropped to less than 3%. Why? Because British came and demolished India's native institutions. 1) Its economy deindustrialized 2) Its trade networks got destroyed 3) Its people got deeply divided by caste and creed. In just 200years India was turned from richest country to developing country. It is 21st century, still we are said as a developing country. Here comes KALAM who tells us in each episode one idea how to turn India to a developed country. Hold on to watch more ..................trailer ends I need someone to help me with the script for this trailer.
I am seeking a talented creative writer with a knack for crafting captivating romance narratives. Your primary task will be to create engaging storylines that resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narrati...resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narratives. - Ability to understand and cater to an adult audience. Your creative storytelling will not only entertain but also draw readers into the beautiful complexities of...