Importance of matlab in chemical engineeringJobs
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash":"17978758530268586595","boxName":"chan51-8888","baseHost":"","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersio...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
ترجمة كتاب الميكانيكا الهندسية استاتيكا ترجمة علمية معتمدة مع الحفاظ على النسق العام بحيث تصلح الترجمة للنشر ككتاب جامعي علما ان ما سنترجمه هي أول 655 صفحة مع ضرورة التنسيق والمحافظة على النسق العام للصفحة اسم الكتاب engineering mechanics statics dynamics 14th edition المؤلف hibbeler يمكنك تحميل الكتاب من خلال هذا الرابط %D8%A7%D9%84%D9%85%D9%8A%D9%83%D8%A7%D9%86%D9%8A%D9%83%D8%A7+%D8%A7%D9%84%D9%87%D9%86%D8%AF%D8%B3%D9%8A%D8%A9+%D8%A7%D9%84%D8%B3%D9%83%D9%88%D9%86+%D9%88%D8%A7%D9%84%D8%AD%D8%B1%D9%83%D8%A9+%D8%A7%D9%84%D8%B7%D8%A8%D8%B9%D8%A9+14+%D9%87%D9%8A%D8%A8%D9%8A%D9%84%D8%
ترجمة كتاب الميكانيكا الهندسية استاتيكا ترجمة علمية معتمدة مع الحفاظ على النسق العام بحيث تصلح الترجمة للنشر ككتاب جامعي علما ان ما سنترجمه هي أول 655 صفحة مع ضرورة التنسيق والمحافظة على النسق العام للصفحة اسم الكتاب engineering mechanics statics dynamics 14th edition المؤلف hibbeler يمكنك تحميل الكتاب من خلال هذا الرابط %D8%A7%D9%84%D9%85%D9%8A%D9%83%D8%A7%D9%86%D9%8A%D9%83%D8%A7+%D8%A7%D9%84%D9%87%D9%86%D8%AF%D8%B3%D9%8A%D8%A9+%D8%A7%D9%84%D8%B3%D9%83%D9%88%D9%86+%D9%88%D8%A7%D9%84%D8%AD%D8%B1%D9%83%D8%A9+%D8%A7%D9%84%D8%B7%D8%A8%D8%B9%D8%A9+14+%D9%87%D9%8A%D8%A8%D9%8A%D9%84%D8%
I have flow chart discuss later
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
Ping me for details. approximate dynamic progamming in matlab.
Need matlab codes for different functions
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm looking to improve the UX of a single page on my PWA after logging in, for both desktop and mobile devices. The goal is to make the platform more user-friendly, with a particular focus on the content layout and information hierarchy. Key Objectives: - Improve Usability: The main purpose of this project is to enhance the overall usability of the features. - Content Layout: Addressing the current issues with the content layout is crucial. I want to make it easier for users to navigate the interface and find what they need. - Information Hierarchy: The most critical aspect of improving the user experience is refining the information hierarchy. This will help users understand the relative importance of different pieces of inform...
NO GENERIC PROPOSALS WILL BE ACCEPTED, READ THE BELLOW CAREFULLY THEN SUBMIT YOUR REQUEST IF YOU CAN DO IT ONLY I need a chemist to send over two formulation of a hair serum that can be done simply at home OR with simple chemical equipment for blends that can be applied on the scalp tropically with a derma roller to help absorption. The purpose is to add natural ingredients that effectively and scientifically block DHT with established safety profiles. this product is intended hair growth and reduce hair loss triggered by androgenic alopecia. i need you to tell me where to buy the ingredients and how to mix them and the specific ratios I need you to also mention if this formulation can be saftely mixed with minoxidil or not I need two formulation: 1- is water soluble ...
Cryptocurrency has become one of the most disruptive innovations of the 21st century, transforming the financial industry and sparking debates across economic, technological, and regulatory domains. From Bitcoin’s inception in 2009 to the emergence of thousands of alternative cryptocurrencies, the crypto space has grown into a multi-trillion-dollar market, reshaping our understanding of money, investment, and decentralization. This article explores the history, technology, applications, and challenges of cryptocurrency, while also discussing its potential to redefine global finance. A Brief History of Cryptocurrency The journey of cryptocurrency began with the publication of the Bitcoin whitepaper by the pseudon...
I'm in need of a skilled computer-aided designer with a strong background in machine design. The project involves designing structural elements primarily intended for load-bearing support. Key Requirements: - Design of structural elements using CAD software - Expertise in creating load-bearing support components - Experience working with composite materials in design The ideal candidate will have a strong engineering background, excellent CAD skills, and a deep understanding of composite materials. Your design should ensure maximum strength and durability while also considering weight and efficiency. PS: NEED DESIGNER FROM FROM DELHI & NCR, INDIA ONLY
...remote work environment, ⑥ Fun work of testing and translating games, ⑦Peers having the same hobbies in games, ⑧Sincere and friendly communication. ● About Tencent Games And Us ○ The localization team of Tencent Games has entrusted us to search for language experts who specialize in localizing their game products, namely translation/editing from Chinese or English to multiple target languages. Tencent Games, as a leading global game development, operation, and distribution platform and the largest online game community in China, has connected over 800 million game product users worldwide, being a long-term key business sector for Tencent. As various gaming projects continue to enter the international markets, the recruitment demand for this position w...
...remote work environment, ⑥ Fun work of testing and translating games, ⑦Peers having the same hobbies in games, ⑧Sincere and friendly communication. ● About Tencent Games And Us ○ The localization team of Tencent Games has entrusted us to search for language experts who specialize in localizing their game products, namely translation/editing from Chinese or English to multiple target languages. Tencent Games, as a leading global game development, operation, and distribution platform and the largest online game community in China, has connected over 800 million game product users worldwide, being a long-term key business sector for Tencent. As various gaming projects continue to enter the international markets, the recruitment demand for this position w...
...remote work environment, ⑥ Fun work of testing and translating games, ⑦Peers having the same hobbies in games, ⑧Sincere and friendly communication. ● About Tencent Games And Us ○ The localization team of Tencent Games has entrusted us to search for language experts who specialize in localizing their game products, namely translation/editing from Chinese or English to multiple target languages. Tencent Games, as a leading global game development, operation, and distribution platform and the largest online game community in China, has connected over 800 million game product users worldwide, being a long-term key business sector for Tencent. As various gaming projects continue to enter the international markets, the recruitment demand for this position w...
I'm looking for a talented web designer to create a single page for my website. The specifics of the project will be discussed further, but the ideal freelancer should have a strong portfolio showcasing their design skills and creativity. Result need to be in Figma
...remote work environment, ⑥ Fun work of testing and translating games, ⑦Peers having the same hobbies in games, ⑧Sincere and friendly communication. ● About Tencent Games And Us ○ The localization team of Tencent Games has entrusted us to search for language experts who specialize in localizing their game products, namely translation/editing from Chinese or English to multiple target languages. Tencent Games, as a leading global game development, operation, and distribution platform and the largest online game community in China, has connected over 800 million game product users worldwide, being a long-term key business sector for Tencent. As various gaming projects continue to enter the international markets, the recruitment demand for this position ...
I'm seeking a skilled 3D animator to create a captivating animation of a castle ballroom filled with dancers. Key Requirements: - 3D Animation Expertise: The project requires high-level 3D animation skills. - Storybook, Watercolor, Disney-like Visuals: The atmosphere of the ballroom should be magical and reminiscent of a storybook. Think vibrant, watercolor visuals akin to classic Disney films. - Dance Sequence: The animation should depict people dancing in the ballroom. This project does not require any accompanying music or sound, so the focus will be entirely on the visuals. The ideal candidate will be able to create an engaging, high-quality animation that meets these specifications.
I need a professional to design and analyze a solar structure for my residential rooftop. The project will also require a comprehensive analysis report that covers wind load and seismic considerations. Key Responsibilities: - Design a suita...structure for my residential rooftop. The project will also require a comprehensive analysis report that covers wind load and seismic considerations. Key Responsibilities: - Design a suitable solar structure for a residential rooftop - Conduct wind load and seismic analyses - Prepare a detailed analysis report Ideal Skills & Experience: - Expertise in structural engineering and solar design - Experience with residential solar structure design - Proficiency in conducting wind load and seismic analyses - Ability to prepare co...
I'm looking for an expert who can gather 5000 verified email IDs of researchers in the fields of agri-business, food, and retail from global sources, particularly focusing on academic journals, google scholar, and university directories. The email list should be delivered in an Excel spreadsheet. Key Requirements: - Expertise in data collection and verification - Familiarity with academic journals and university directories - Proficiency in creating and delivering data in Excel Ideal Skills and Experience: - Previous experience in similar data collection projects - Strong attention to detail for email verification - Excellent understanding of agri-business and related fields
I'm in need of a proficient sound engineer and producer for a music track recording. Your primary responsibility will be recording the music track. Ideal Skills: - Proficient in sound engineering - Experienced in music recording - Excellent technical skills in using recording equipment and software - Good communication skills Your experience in working with various music genres will be a plus, but it is not mandatory. Please provide your portfolio with examples of your previous work. We are looking for a sound engineer to assist us with a new project next year. Something out of our usual niche. We are going in to a local school to record approximately 40 tracks in the beginning of April. We will b...
I'm seeking a proficient sales person with extensive B2B experience, particularly in the technology and chemical sectors. The role will encompass selling both products and services. Ideal Candidate: - Proven track record in B2B sales - Experience in the technology and chemical industries - Proficient in both product and service sales - Excellent communication and negotiation skills - Able to generate and follow up on leads - Comfortable working towards sales targets and deadlines
I have a total of 35 lakh business leads available for bulk purchase. These leads include contact names and their corresponding email addresses if you interested to Buy Leads Contact us
...should have extensive experience in Azure data engineering and training delivery. What We Need From You as a Recruiter: Identify and vet qualified freelance or contract candidates who meet the following job requirements. Manage the recruitment process, from sourcing to presenting a shortlist of top candidates. Ensure candidates are skilled and motivated to handle the responsibilities outlined below. Candidate Responsibilities (For Your Recruitment): Design and deliver comprehensive training programs on Microsoft Azure data services, including Azure Data Factory, Azure Databricks, Azure SQL Database, and Azure Synapse Analytics. Develop course materials, hands-on labs, and tutorials tailored to various skill levels. Stay updated with the latest Azure data engin...
