Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 impact of ai in retail jobs fundet

    ...titler, beskrivelser, og billeder, direkte ind i vores online shop. Dette projekt kræver en særlig tilgang, hvor produktinformation genereres ud fra billeder ved hjælp af en AI-generator (tilvejebragt gennem en API vi stiller til rådighed), med fokus på følgende nøgleelementer: Automatisk Titel og Beskrivelsesgenerering: For hvert produkt, et billede uploades, hvorfra AI-generatoren (ChatGPT eller tilsvarende) skal udlede en produkttitel og en detaljeret beskrivelse. Billedet vil indeholde et produktnummer, som er essentielt for vores produktkatalogisering. Målet er at automatisere denne proces, så manuel upload til AI-generatoren minimeres eller elimineres. Produktoprettelse med Variabler: Produkterne skal ...

    €136 Average bid
    €136 Gns Bud
    4 bud

    I must have made a chat robot that can answer chats in a chat program automatically, it must be able to keep a conversation running via chat gpt or similar AI, it must be able to speak both Danish, English and Norwegian. It must be able to answer the texts itself in the window where the text is to be written I has to be able to read previous chats and answers on the website

    €163 Average bid
    €163 Gns Bud
    3 bud

    Hello! I am looking for a talented designer to create a banner for me. This banner needs to be 33.5" x 80" and will be used to promote a specific event. The designer for the banner should use Adobe Photoshop and keep in mind a specific color scheme that I have in mind. The final file should be provided as a 300 DPI. The ideal designer for this project should have experience cutting large and intricate banner design. If you believe you are up to the task, please apply to the project. Thank you and I look forward to discussing the project with interested applicants. The logo AI and colors will be sent Reference:

    €41 Average bid
    €41 Gns Bud
    28 bud

    If you have evanto elements subscription and willing to share it , please DM me

    €12 / hr Average bid
    €12 / hr Gns Bud
    2 bud

    In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash":"17978758530268586595","boxName":"chan51-8888","baseHost":"","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersio...

    €41 Average bid
    €41 Gns Bud
    12 bud
    Ai project
    Udløbet left

    designing AI.....................

    €61 Average bid
    €61 Gns Bud
    9 bud

    The creation of a virtual office

    €159 Average bid
    €159 Gns Bud
    4 bud

    Lav logo fra PNG til AI fil med outline.

    €17 Average bid
    €17 Gns Bud
    19 bud

    ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish

    €196 Average bid
    €196 Gns Bud
    4 bud

    Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid

    €148 Average bid
    €148 Gns Bud
    5 bud

    Logo designing

    €73 Average bid
    €73 Gns Bud
    21 bud
    €12 / hr Gns Bud
    4 bud
    Build of models
    Udløbet left

    Autocad designing

    €272 Average bid
    €272 Gns Bud
    6 bud
    Blog posting
    Udløbet left

    Blog posting for retail store.

    €5 / hr Average bid
    €5 / hr Gns Bud
    11 bud

    COPY OF AN ECOMMERCE SITE NEED My budget 30 usd

    €28 Average bid
    €28 Gns Bud
    2 bud

    01- CAN NOT USE google API 02 - Need code for android ''navigation'' & coordinate locator on OWN MAP 03 - OWN MAP is a small area of 20 km x 10 km - have in AI format

    €619 Average bid
    €619 Gns Bud
    11 bud

    Design A Catalog Of Products (1 Page)

    €17 Average bid
    €17 Gns Bud
    12 bud
    €29 - €29
    0 bud
    Android App
    Udløbet left

    Tablet - Online Retail App

    €945 Average bid
    €945 Gns Bud
    1 bud

    /findtranscript/ error.. pls fix

    PHP
    €18 Average bid
    €18 Gns Bud
    17 bud

    poster for online posts 3 pictures Bold

    €21 Average bid
    €21 Gns Bud
    13 bud

    Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

    €147 - €441
    €147 - €441
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €147
    €18 - €147
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud

    Tunne a linux server

    €145 - €145
    €145 - €145
    0 bud

    im looking for an estimate on creating a cad drawing of the ring that i uploaded

    €29 - €242
    €29 - €242
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Insert QR codes into large AI vector graphics file'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    As per skype conference

    €436 Average bid
    €436 Gns Bud
    1 bud

    Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...

    €387 Average bid
    €387 Gns Bud
    5 bud

    ...assist in the redevelopment of a specialized marketplace platform. Below are the comprehensive requirements for the project: 1. API Retrieval and Optimization: Retrieve integrated APIs (Eden AI, Salesforce, Getty Images, Azure, OpenAI). Assistance may be required for inaccessible accounts due to geographical restrictions. 2. Domain & Email Integration for Local Market: Build a robust system for selling AI domains and email registration, specifically catering to the region of Anguilla. Ensure compliance with local copyright laws. 3. Enhanced User Experience via Icons: Replace traditional category representations with visually appealing side-by-side icons for all features. Description texts will be provided and need to be properly placed. 4. Regulat...

    €526 Average bid
    €526 Gns Bud
    21 bud

    We are seeking a talented branding expert to help us establish a strong identity for our start-up company. Your role will involve creating a compelling brand strategy, designing a memorable logo, and devel...designing a memorable logo, and developing visual materials that resonate with our target audience. Additionally, UI design is our top priority, ensuring an engaging and user-friendly experience that attracts and retains users. Experience in SEO and digital marketing would be highly beneficial, along with expertise in social media design to craft visually appealing and impactful content. If you have a passion for innovation, brand storytelling, and creating a strong digital presence, we want to hear from you! This is a fantastic opportunity to make a significant impa...

    €445 Average bid
    €445 Gns Bud
    81 bud

    ...developer to create a personalized AI assistant app tailored for realtors. The AI should be capable of generating property listings, drafting social media posts and email scripts, synchronizing with Google Calendar, providing neighborhood statistics, and creating checklists. Key Features: - Generate property listings and social media posts - Draft email scripts and sync with Google Calendar - Provide neighborhood statistics and create checklists Integration Needs: - Seamless compatibility with Google Calendar - Interaction with Facebook - Connection to MLS (Multiple Listing Service) Personalization: The AI's interactions should be more than just basic templates. It should be able to provide personalized responses based on user data. An understanding of...

    €1221 Average bid
    €1221 Gns Bud
    50 bud

    Queremos desarrollar un agente de ventas telefonicas con inteligencia en artificial en español, el cual lo alimentemos con una base de datos de clientes existentes, a los cuales el agente intentara venderle un upgrade de su servicio existente y si el clie te acepta enviar una notificación al digitador para la carga en los sistemas. Podra ser en las plataforma como retell AI, Vapi, o dialogFlow de Google, y usar firebase como base de datos. Preferiblemente el programador debe hablar español

    €553 Average bid
    €553 Gns Bud
    9 bud

    We're looking for publication ready transcripts of 2 x 1.5 hour focus groups run with professional participants in the UK . We would anticipate each group to be approximately 2.5-3 hours of work. The focus groups have already been partially transcribed through , and we will be able to provide you with this partial transcript if required. However, we need these to be significantly further edited and corrected - including removing repetition and speech inflections, and identifying individual speakers. We would be able to provide you with audio files once the job has been confirmed and would need these returned within two weeks.

    €392 Average bid
    €392 Gns Bud
    25 bud

    I'm seeking an AI developer to create an intelligent system that checks legal documents, specifically concerning 'Right to Manage' procedures, against our database. Key Requirements: - The AI must validate specific aspects of the procedures such as the notification processes. - It also needs to ensure that data from our database is correctly imported into notices. - Experience with legal document analysis is a plus. Ideal Skills: - Proficiency in AI development and programming. - Experience with data analysis and validation. - Understanding of legal processes, particularly 'Right to Manage' procedures. - Ability to create and implement an efficient AI system for document review.

    €2510 Average bid
    €2510 Gns Bud
    20 bud

    I am looking for an Open AI professional who can help in automating voice responses for a technical support call center, similar to PayPal's system. Key Responsibilities: - Implement voice AI to handle technical support calls. - Ensure integration with appropriate systems and platforms. - Develop the system to troubleshoot and resolve issues at a complex level. Ideal Skills: - Proficient in Open AI and voice automation technology. - Experience in setting up technical support call centers. - Strong understanding of AI's capabilities in diagnosing technical issues. The project will be carried out based on detailed instructions provided. Please reach out if you have the right expertise and experience.

    €242 Average bid
    €242 Gns Bud
    6 bud

    ...authentication and handle IP address rotation to ensure efficient, anonymous browsing. Work with an existing AI ChatGPT script and adapt it to load a URL via premium proxies while maintaining performance. Update and optimize the script with the latest Python libraries to ensure the process is smooth and reliable. Test and troubleshoot the script to handle errors, timeouts, and proxies rotation effectively. Ensure proper logging and error handling throughout the script to keep track of proxy usage and webpage requests. Collaborate with the team to meet project deadlines and requirements. Requirements: Proven experience with Python programming, especially in web scraping or automation. Strong knowledge of proxy management and handling authentication (username ...

    €112 Average bid
    €112 Gns Bud
    8 bud

    I'm in need of an AI voice robot specifically for my restaurant. This bot will help in taking orders (both for delivery and dine-in), handling reservations, and answering FAQs. The bot should trigger a payment link via GHL on stripe once an order is placed. It should also update our Client POS after the payment is received. Key Responsibilities: - Taking orders: The AI should efficiently manage the order-taking process. - Handling reservations: The bot should help in managing table bookings. - Answering FAQs: The bot should have a comprehensive understanding of the restaurant's FAQs. - Payment process: After an order is placed, the bot needs to trigger a payment link. - Delivery Management: The bot should handle delivery o...

    €824 Average bid
    €824 Gns Bud
    13 bud

    ...Python Developer for MyAi (Equity-Based) ? Position: AI-Powered Trading Bot Developer (Python) ? Compensation: Equity-Based (5-15% based on contribution & milestones) ? Location: Remote (Flexible) ? Commitment: Part-Time / Full-Time ? About MyAi MyAi is an AI-driven, next-gen trading system designed to outperform hedge funds & protect retail traders from market manipulation. Our goal is to build a highly intelligent AI trading bot that integrates quantum AI, deep learning, and reinforcement learning for ultra-accurate market predictions. We are looking for a highly skilled Python developer with experience in AI trading models, machine learning, and market analysis to help develop MyAi's AI engine. ? Key Responsibi...

    €4505 Average bid
    €4505 Gns Bud
    3 bud

    ...they can access information without needing a data connection. - Map Integration: The app should seamlessly integrate with maps to help users navigate their destinations. - AI Feature: I'm particularly interested in incorporating an AI feature, which could provide personalized recommendations or assist users in planning their trips. Ideal Skills: - Cross-Platform Mobile App Development: Experience in developing apps for both iOS and Android is a must. - UI/UX Design: The app should have an intuitive and attractive interface. - AI Integration: Experience in incorporating AI features into apps is highly desirable. - Knowledge of Booking Systems: Familiarity with developing or integrating comprehensive booking systems wil...

    €1819 Average bid
    €1819 Gns Bud
    5 bud

    I need a freelancer to open an Adobe Illustrator (.AI) file and provide screenshots of the font family used in different sections of a website design. Sections to include: - Header menu items: Only the default state - Headings - Paragraph text - Footer area - Sidebar elements - Button text Additionally, I require the screenshots to show a combination of the entire section layout and just the font and text details. This is a time-sensitive task, and I require the work to be completed within the next couple of hours. Please only bid if you are available to start immediately. Looking forward to your proposals. Thanks!

    €15 / hr Average bid
    €15 / hr Gns Bud
    78 bud

    ALL AI SUBMISSIONS WILL BE AUTOMATICALLY REJECTED I need a designer to improve the color scheme of my fishing knots flashcards. The current scheme needs to be upgraded to a bright and vibrant palette that will appeal to experienced anglers. The flashcards should also carry a nature-inspired visual theme. Ideal Skills: - Graphic Design - Color Theory - Understanding of Fishing and Nature Please provide samples of your previous work that align with this project. The current color scheme feels more like a hunting/camping color. Please change it to where it fits better with water/ocean/river kind of color scheme.

    €29 Average bid
    €29
    18 indlæg

    ...on automated people counting in retail stores, and we need human validation to ensure accuracy in our system. Task Overview: We need a detail-oriented person to watch a series of short store surveillance videos and manually count the number of unique customers and staff members entering the store. Your validation will help improve our AI model's accuracy. Key Details: Purpose: This is part of a machine learning system that tracks foot traffic in retail stores. Your counts will help refine our AI's ability to differentiate between customers and staff. Task Requirements: Watch 12 short videos (each about 2 minutes and 30 seconds) per store. Videos ...

    €6 / hr Average bid
    €6 / hr Gns Bud
    3 bud