Guilford county department of health and human servicesJobs
...programmer, this is a long term project. Prefer to developers who have experience of this type of website. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Adifier Child Theme (Classified Ads WordPress Theme) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Currently have a website issue that needs to be fixed on Hosting is with Hostinger and I reached out to them for help and this is the reply: To help reestablish the connection between your Adifier theme and the WordPress database for the recent ads, you can try the following steps: Clear Cache: If you are using a caching plugin or your hosting provides caching services, clear the cache. Sometimes, outdated cached files...
Vi er en IT startup, der er specialiseret i Microsoft Cloud solutions og vi beskæftiger os med at udvikle managed services til Microsoft Økosystem.
I am in need of webscraping services for Danish Law. Specifically, I would like the data to be scraped from Danish law websites. No translation is necessary as I plan to use the data in Danish. Additionally, I would prefer that the data be directly imported into a database for my use. If you have experience with Danish legal webscraping and are comfortable with this project, I am eager to work together to get this project accomplished. The deliverables are code, sub-domain URLs from three websites + the scraped content. The target web-sites are , and
Hej Md A., Jeg vil gerne give dig et job til 10 ¤ for udvikling af min logo.
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash"...keys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You can test her...
A new hosting company is arising from Scandinavia, and are looking for a Lead Designer who can control and engage in the Wordpress theme setup and functional design. The Website is supposed to be multilangual, by using WPML, and the control panel for the Hosting services is supposed to be build into Wordpress. For the sake of this, the designer will be required to think outside the box, and be able to work from a framework-thinking. The Wordpress tool WHMCS is not part of the project. Find ideas from:
...gender in the end, though. But women ROCK! ;) I will need something visual and/or clickable since I do not speak "tech" at all. It's like reading Mandarin or Swahili to me. Must work in the WP theme Astra. I can't provide link just yet to the Astra theme, since the developer is unavailable for a few days. We can buy the PRO version if needed. Go to The site is in danish, but the functions will be more or less the same. The job is ONLY for the price calculator with the green slider input, some variables as add-on choices with a preset default value, and the price with an output. We need a slightly simpler version of the taxi-calculator, so it will fit into smaller space. Instead of the drop-down choices: Vælg by/område (S...
The creation of a virtual office
...EVENT. Altså Skandinaviens bedste hjemmeside indenfor Sex & Erotik til computer og mobilen. En annoncør/udbyder skal have mulighed for at oprette en konto på Sex & Erotik. Og fra denne konto, kan annoncøren/udbyderen uploade sine tilbud indenfor Sex & Erotik til den nye hjemmeside i nogle faste rammer, med tekst og et antal bestemte billeder, eksempelvis optil 9 billeder, og derved tilbyde sine services. Hver annonce er én annonce, og vil være gældende i en periode på 4, 12, 24 eller 48 uger, hvorefter at den automatisk slettes. 1 Annonce, 1 Betaling. Eksempelvis én Stripper annonce. Indledningsvis vil vi tilbyde alle en gratis prøve periode på 4 uger. Hvorefter der kan fortsættes, til meg...
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
Hello designers. My boss is looking for a logo that combines three different categories under the insurance umbrella. Home - Health - Car. Design anything you want that combines these 3 categories, in the insurance industry. Thanks
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Private and small group tours in Tuscany (Italy); top quality services with luxury vehicles and knowledgeable driver/guides. NO TOURIST TRAPS OR CHEAP CROWDED BUS TOURS WITH 50 OTHER PEOPLE ONLY REAL AND MEMORABLE EXPERIENCES
Design A Catalog Of Products (1 Page)
Hej, har brug for at få designet et logo. Jeg arbejder selvstændigt. Har en veninde som akkurat har fået designet et logo som jeg synes godt om (måske med lidt ændringer. Veninden har fået designet logo til af en designer kaldt Chippie - måske det ville være smart at samme person fortsætter. Mit firma hedder og underteksterne skal lyde 'subsea services' ... vedhæfter logo som skal inkorpereres i mit nye logo (bemærk at dette logo er registreret og har ophavsret, men jeg har fået tilladelse skriftlgt). Glæder mig til at høre fra Chippie - eller en anden designer snarest muligt. Prismæssigt ved jeg at Marlene Biegel betalte USD 50,- for hendes logo
Jeg arbejder på en kortspil hvor spillerne bygger en lille by op og derfor skal jeg bruge en eller flere til at tegne nogle characters til mit spil. Det skal være 4 racer: Human (mennesker), Alien, Mech (Fremtids robotter), Undead (zombier, spøgelser osv.) Det skal være meget pixileret men stadig detaljeret.
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
Vi er en konsulentvirksomhed med speciale i leder- og organisationsudvikling rettet mod virtuelle organisationer og ledere, der opererer med medarbejdere og teams på distancen. P.t. arbejder vi med danske og internationale organisationer og vores kunder er bl.a. Statoil, NNIT, Chr Hansen, DLG, Vejdirektoratet, Atkins, Falck o.a. Vi har eksisteret i snart 10 år. Vi har behov for en free lance salgschef der som primær succeskriterie skal booke møder for os i Danmarks 500 største virksomheder og de 50 største kommuner. Det kan være overfor direktører, HR managers o.lign. Vi tænker os en aftale med fee pr afholdt møde. Alternativt 1 fuld dag pr uge. Det kan komme på tale at varetage mailkampagner, elektronisk markedsf&osl...
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
...4-9 years of product development and Implementation experience with a proven track record of delivering high-quality products using BMC Remedy ARS/BMC Helix as a development platform. Proficiency and prior experience in ARS Development using ARS Forms & ARS objects - Active Links, Filters, Escalation, Active Link Guides, Filter Guides, Menus, Web Services, and Applications. Very Good Exposure to Remedy Integrations using the latest version of Remedy APIs, ARS workflow, Integrations with SRM, Incident, Change, Work Order and CMDB Module. Strong know-how of functional and design aspects of the BMC Remedy ITSM Suite is a must. Experience in developing enterprise software products, in a fast-paced, distributed,...
I'm looking for a seasoned professional to help me set up a bulk email campaign using the Odoo Email Marketing model. The focus of this campaign is to promote our products/services to our existing customer base. Requirements: - Proficient in Odoo's Email Marketing module - Experience in creating and managing bulk email campaigns - Skilled in designing engaging email content that includes text, images, and links The ideal freelancer for this project will have a proven track record in email marketing, particularly using Odoo. They should be capable of crafting compelling email content that drives customer engagement and boosts product awareness.
I'm seeking a seasoned SEO content writer to enha...aimed primarily at lead generation. The ideal candidate should possess: - In-depth understanding of SEO best practices - Exceptional writing and editing skills - Proven ability to create engaging content that ranks well on search engines Your responsibilities will primarily revolve around crafting SEO-friendly content for our landing pages, with potential for other content types including blog posts, product descriptions, and articles, depending on your skills and our needs. Please note, while I have not specified topics for the content, a broad understanding and interest in technology, health and wellness, and finance and investing will be beneficial. Your ability to...
...interactions, increase engagement, and drive sales of PPV (pay-per-view) photos and videos. What We Need: AI Integration: Leverage ChatGPT’s API to develop an AI that can: Engage subscribers in seductive and natural conversations. Build relationships to maintain subscriber interest. Sell pre-uploaded media (photos/videos) using predefined scripts. Customization and Training: Educate the AI to: Mimic the personality and style of creators (models). Adapt dynamically to individual subscriber behavior (e.g., focus on engagement or sales). Browser Automation: Since does not provide an API, develop browser automation scripts to: Log into accounts, read subscriber messages, and send AI-generated responses. Manage media deliver...
...including a clear and engaging homepage, a services overview, a blog section, and a user account section. Additionally, it should feature contact forms, client testimonials, and SEO optimized content. Key Project Elements: - Develop a Corporate Site: The site should reflect a professional corporate image and cater to our lead generation goals. - Comprehensive Site Features: The site should include a clear and engaging homepage, a services overview, a blog section, and a user account section. - Interactive Elements: Contact forms and client testimonials should be integrated into the site. - Mobile Friendly Design: The site must be responsive and provide a seamless experience across devices. - SEO Optimized Content: A...
I'm seeking a professional to set up an AI call answering service for me. I receive around 100 calls a month, which is manageable. The primary role of this AI service would be to ask a number of questions, record the answers and then email them to a mailbox. The service only needs to support English. Skills and experience that would be ideal for this project include: - Prior experience with AI call answering services - Understanding of call logging and summarization - Proficiency in English
I'm in need of a travel agency poster. The main purpose of the poster is to highlight our agency's services, with a key focus on our exclusive deals and discounts. The preferred style for the poster is classic and elegant, so it should embody this aesthetic while still being clear and informative. Skills and Experience: - Graphic Design - Marketing - Poster Design - Understanding of Classic and Elegant Aesthetics - Experience in Travel Industry Design preferred.
...(grammar, punctuation, sentence structure). -Ensure all pages are Google-appropriate and error-free. -Make the website mobile-friendly across all devices. -Simplify and customize the chatbox. Remove unnecessary features and make it functional. Page-Specific Tasks Home Page: -Ensure headings are on one line and visually appealing. -Apply the same heading style to all other pages (About, Projects, Capabilities, Why Choose Us, FAQs, Director Profile, Careers, Contact Us). -Fix the subheading to read: “Our Vision, Our Mission & Our Core Values.” Our Vision, Our Mission & Our Core Values Page: -Make all headings, subheadings, and body text the same size, style, and color as the Home Page. -Adjust sentences, line spacing, and...
...Hands-on knowledge of either AWS or Azure, with a good understanding of similar services running on the other platform. Cloud-Native and Hybrid Systems Cloud Concepts: In-depth understanding of cloud computing principles, including compute, storage, and networking. Familiarity with hybrid cloud and multi-cloud deployment strategies. Scalability and High Availability: Networking Fundamentals Network Architecture: Strong understanding of network topologies and design principles (e.g., LAN, WAN, VPN, Subnets). Knowledge of routing, switching, and DNS configurations in platform-agnostic environments. Virtual Private Cloud (VPC): similar terminology in Azure Understanding of virtual networking...