General terms and conditions of saleJobs
...tiling shop and have the product page and ordering process similar to: or What's important: - Price entry in the backend should be in m² - We should display the price of m² and the price of a box with its contents. - The visitor will enter the surface he needs, it will be rounded up to the next number of boxes that cover that area. - Or he will enter the number of boxes and see how much that is in terms of area. - Both fields are interconnected. - Show the total cost of his order. I will give you more details via chat if needed. I am really looking for someone with good english who can understand the whole picture and do what's
For our company in denmark i need to have transfer pricing dokumentation made based on sale from our head office in denmark to a company we own in Norway. I need it asap.
...First task is mainly in shopify and mailchimp. It's on the site: Good English language skills are important for future good communication. 1. Set up mailchimp so its ready to use. There need to be a pop up on the front page where people can sign up for the newsletter. Text for signup box needs to be simple with the same colours as the website. Title: Nyhedsbrev Text: Tilmeld dig og få adgang til eksklusive tilbud og deals. 2. I need a banner in the top of the website with the following text: Lagersalg! Vibeke Klint tæpper fra NORDICMODERN, Sted: Nordicmodern, Søllerødvej 111, 2840 Holte. Åbningstider: Lørdag d. 2. april kl. 10-15 & Søndag d. 3. april kl. 10-15. The colours of the banner need to...
DataForce er en verdensomspændende dataindsamlings-og mærkningsplatform, der kombinerer teknologi med et mangfoldigt netværk af mere end en million databidragsydere, forskere og ingeniører. DataForce tilbyder virksomheder inden for teknologi, bilindustrien, biovidenskab og andre industrier, sikre og pålidelige KI-tjenester med henblik på exception...i vores igangværende og fremtidige betalte undersøgelser. Alle kan deltage. Vores projekter kan foregå hjemme eller på et af DataForces kontorer. Få en yderligere indtægt ved at være bidragsyder: Alle undersøgelser er betalte, og deres varighed varierer fra få minutter til få timer. Interesseret? Klik på nedenstående link for at f...
We have an template: ...should be like this: . We need to have pages for terms & Conditions etc etc... We need to have WPBakery Page Builder for WordPress to work perfectly into the system. We have a module for Affiliate for privates ( 10 - 15% ) that shall work. We need a login for B2B clients that can see the cost-price for them. We need shipping to be integrated with: We need to implement gateway: There shall be a small blog. There shall be a FAQ like this: Mailsystem for newsletter We work in english - but change to danish when we are done. We buy pictures from Shutterstock and we give you danish text.
Monkey Puzzle Ref App [Removed for encouraging offsite communication which is against our Terms and Conditions -Section 13:Communication With Other Users]
I need 2 posers done, for selling kayaks. Color: 4+0 Size: 79 x 119 cm Must look like summer & sun - thats is what we are selling. POSTER 1 TEXT: Header: Kajakken som alle kan sejle H2: Perfekt til sommerhuset H3: Sæt dig ned i den, og sejl afsted H4: Bestil idag, og vi leverer uden beregning. POSTER 2 TEXT: Header:...we are selling. POSTER 1 TEXT: Header: Kajakken som alle kan sejle H2: Perfekt til sommerhuset H3: Sæt dig ned i den, og sejl afsted H4: Bestil idag, og vi leverer uden beregning. POSTER 2 TEXT: Header: Nem og stabil kajak H2: Til børn og voksne H3: Perfekt til sommerhuset H4: Bestil idag, og vi leverer uden beregning. I have uploaded some pictures for using. I have also uploaded a picture of the sign that the poster is for. F...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Hi, We need general text about flights. Written in simple, understandable sentences. Length: 3000 signs with spaces or 450 words Theme: 4 paragraphs about 1. Travel by plane - it’s safe, fast, cheap and comfort 2. When is the best moment for ticket reservation - 3 month before short travel, 5-6 month before intercontinental flights 3. Differences between low cost carriers and regular airlines - price (lower / higher), luggage politic (free hand luggage, paid registered luggage / free luggage), routes (continental / continental and intercontinental) and others. 4. What can I take to plane (to hand luggage)? (eating, drinks and others) What we want: • We like keywords: cheap flights, cheap tickets. It would be great if you will ...
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
Vi søger freelance konsulenter til telefonisk fra egen lokation eller vort kontor at arrangere møder indenfor forsikring, IT og reklame. Der faktureres fra din side, når mødet er gennemført. Provisionen er en procentuel del af vor pris for mødet. Vi arbejder ud fra etiske retningslinier, f.eks. ...fra etiske retningslinier, f.eks. at vores organisation skal være så transparent som muligt. Derfor er de priser vi tager for møderne selvfølgelig frit tilgængelige for dig som samarbejdspartner. Vi har brug for både dansk-, engelsk- og svensk talende personale. Vi sørger for al software, softphone og holder personalemøde [Removed for encouraging offsite communication which is against our Terms ...
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
General Web develpment PHP, Html, Css, Javascript devlopement for our clients
for sale EMAILS skype:
Whatsapp channels & active numbers for any country available for sale. I have full database of whatsapp for across the world. I can even filter any list of mobile numbers Whatsapp secure password protected channels are also available for sale
poster for online posts 3 pictures Bold
I need someone writing a number of good SEO quality articles for a new real estate website. For instants: "Are you looking for buying a new flat in London? Do you like to live in the middle of London? Do you wish to..." 1. Articel/blog about: "Flats for sale" 2. Articel/blog about: "Flats for rent" 3. Articel/blog about: "Student residence for rent" 4. Articel/blog about: "Residential rental" 5. Articel/blog about: "Property in London for rent" 6. Articel/blog about: "Property in London for sale" The size of each article should be like: "Lejlighed København Kunne du tænke dig at gå en tur på Langelinje om morgenen, shoppe i but...
I need someone writing a number of good SEO quality articles for a new real estate website. For instants: "Are you looking for buying a new flat in London? Do you like to live in the middle of London? Do you wish to..." 1. Articel/blog about: "Flats for sale" 2. Articel/blog about: "Flats for rent" 3. Articel/blog about: "Student residence for rent" 4. Articel/blog about: "Residential rental" 5. Articel/blog about: "Property in London for rent" 6. Articel/blog about: "Property in London for sale" The size of each article should be like: "Lejlighed København Kunne du tænke dig at gå en tur på Langelinje om morgenen, shoppe i but...
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
...Kingdom of Dancing Stars In a distant planet, beyond the clouds, existed a magical kingdom called Estrelaria. This place shimmered with stars day and night, and its inhabitants lived in harmony with celestial light. Personagens (Characters) 1. *Luna*: An 8-year-old curious and dreamy girl with silver hair and starry eyes. 2. *Estrelinha*: A mischievous, winged creature with butterfly wings and radiant hair. 3. *King Sol*: The majestic ruler of Estrelaria, with fiery hair and solar eyes. A História (The Story) Luna, living on Estrelaria's outskirts, loved hearing star stories and dreamed of flying among them. One day, she found lost Estrelinha, who spoke of the endangered Kingdom of Dancing ...
I'm in need of two realistic digital portraits of the historical figures 'Cyaxares' and 'Nabopalassar.' The portraits should be in a style similar to that of the "History Explained" YouTube channel, which features impressive custom portraits of historical figures. I will attach screenshots from that channel of what I would want my two figures to look like. So to be clear, they would look similar to these screenshots, but still unique in their own ways. In the attached image depicting 3 kings, the one on the far right is Nebuchadnezzar. The character I want comissioned, 'Nabopalassar,' is his father. So I hope that would help in creating someone similar to what is attached. Key Requirements: - The style...
...below my main concern is making it look sleek and futuristic modern minimalist type. Please let me know what you think is best we already have a domain and website This is for the funnel page to sub tornaments page to funnel people to wrestling tournaments .com The description is below I also potentially need digital flyers and digial posts for promoters Home page THE NEW META OF GRAPPLING TOURNAMENTS Are you tired of: Waiting around long past your start time? Overspending only to get ONLY TO GET YOUR ASS SANDBAGGED IN A SMALL BRACKET? Wasting your entire day at a tournament? If any of these sound familiar, click below to learn more! [Learn More] What is Warzone? Why is this the new meta of grappling tournaments? Let me break i...
I'm looking for a professional web designer who can create an E-commerc...web designer who can create an E-commerce website for me. The website should cater to the sale of both physical and digital goods. Key Requirements: - The website must have a seamless integration of a payment gateway. This is crucial as it will allow for smooth transactions and enhance customer satisfaction. - Customer reviews for products should also be incorporated. This will help build trust with our customers and encourage engagement. Ideal Skills & Experience: - Proven track record in designing E-commerce websites. - Excellent understanding of integrating payment gateways. - Experience in setting up product review systems on websites. - Knowledge of...
...a talented digital artist to bring my unique vision to life: a realistic drawing of a lion and a whale stacked vertically. Key Elements: - The lion should be on the bottom, showcasing its strength, while the whale is back flipping, cleverly intertwined with the lion's mane. - The flip could include splashes of water, adding a dynamic element to the piece. - The lion's teeth should be visible, highlighting its ferocity and intensity. The ideal artist for this project should be experienced in creating realistic digital illustrations and have a strong understanding of animal anatomy and movement. A knack for combining different elements into a cohesive and visually striking piece will be essential. In terms of...
I'm seeking an expert to analyze the impact of Gaussian measurement noise on the accuracy of estimating parameters from a second order equivalent circuit model. The primary focus will be on estimating resistance and capacitance. Key components of the project: - Assess the influence of Gaussian noise on model parameter estimation. - Explore the efficacy of the Kalman filter in mitigating the effects of this noise. Ideal candidates will have: - Strong background in circuit modeling. - Proficiency in noise analysis and filtering techniques, especially the Kalman filter. - Experience with parameter estimation of circuit components.
I need a series of articles focused on breast cancer, specifically its prevention and early detection. These articles should be tailored for the general public, written in a formal and informative tone. Key requirements: - Extensive knowledge about breast cancer, particularly in its early stages and preventative measures. - Ability to convey complex medical information in a clear, accessible manner. - Experience in writing health-related articles for the general public. - Understanding of the need for an informative and formal tone, without being overly complex or technical.
I'm looking for an expert to enhance the ranking of my Google My Business page. The primary goal is to increase my local visibility to attract more potential customers. Key Aspects: - Assistance needed in identifying effective keywords and search terms that could improve my ranking. - Guidance on how to best highlight specific services/products on my page to optimize engagement and interest. Ideal Skills & Experience: - Proven track record in local SEO and Google My Business optimization. - Experience in keyword research and identification. - Ability to create engaging content tailored for Google My Business. - Excellent understanding of local customer behavior and preferences.
