Fast english typing speed need jobJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 fast english typing speed need job jobs fundet
    Article job
    Udløbet left

    Write articles for me xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €7 / hr Average bid
    €7 / hr Gns Bud
    1 bud

    i can design Wordpress on Template , code on teamplate ,ex: ://://

    €29 Average bid
    €29 Gns Bud
    1 bud

    Hej. Ser din profil her. Vi er et team, der er ved at udvikle på en nyheds-service, og vi sidder lidt fast på nogle af front-end design tingene. Jeg er på udkig efter nogle friske øjne på opstillingen af et par underside. Kunne du have mod på at kigge på det? Jeg tænker at starte med nogle få timer, så vi lige kan prøve hinanden an. Det kan så udvikle sig til meget mere - vi har en del forskelligt. Flair for godt user flow + responsive er must. Ser frem til dit svar. Sebastian

    €10 / hr Average bid
    €10 / hr Gns Bud
    1 bud

    Hey, Can you please estimate your best price for SEO on my homepage. 1. My homepage: We work with personal finance and bookkeeping. 2. Key Words/ discription...Key Words/ discription •Personal finance: Keywords: privatøkonomi, uvildig rådgivning, gæld, økonomisk rådgivning Discription: rådgivning om gæld, økonomisk rådgivning til private og virksomheder •Bookkeeping Keywords: bogføring, regnskab, skat, moms Discription: bogføring til billig fast pris, selvangivelse og moms, 3. Competitors •Personal finance: 1. 2. 3. •Bookkeeping: 1. 2. 3. If you need any other information, do not hesitate to contact me. Best regards Wasim R.

    €1019 Average bid
    €1019 Gns Bud
    3 bud

    Hey, Can you please estimate your best price for SEO on my homepage. 1. My homepage: We work with personal finance and bookkeeping. 2. Key Words/ discription...Key Words/ discription •Personal finance: Keywords: privatøkonomi, uvildig rådgivning, gæld, økonomisk rådgivning Discription: rådgivning om gæld, økonomisk rådgivning til private og virksomheder •Bookkeeping Keywords: bogføring, regnskab, skat, moms Discription: bogføring til billig fast pris, selvangivelse og moms, 3. Competitors •Personal finance: 1. 2. 3. •Bookkeeping: 1. 2. 3. If you need any other information, do not hesitate to contact me. Best regards Wasim R.

    €734 Average bid
    €734 Gns Bud
    1 bud

    We are a company searching for Danish native speakers to assist in the operation of an internet chat. We have already been running this project for some time, and in more than 10 countries. All software is web-based and training will be provided. Requirements: Native Danish in writing Available on Skype most of the day Computer with a fast internet connection Applicants must also have a good level of English At least 18 years old Ideal applicants should be reliable, flexible, and also open-minded, creative, Have a good sense of humor Available to work shift We make quick and prompt monthly payments.

    €6 / hr Average bid
    €6 / hr Gns Bud
    2 bud

    Mobilselskabet GreenSpeak søger en front-end webudvikler, som kan hjælpe os med at forberede vores hjemmeside til l...arbejde selvstændigt men du vil få meget støtte fra Telenors eksperter. Du skal også have din egen computer med de nødvendige programmer. Arbejdstiderne er minimum en hverdag om ugen og gerne mere efter aftale i Telenors kontorer i København. Arbejdet giver rig mulighed for at udvikle nye evner og få erfaring i professionelle rammer. Bliver GreenSpeak en succes og har du vist dit værd, vil en fast stilling være en mulighed. Fremtidige opgaver vil bl.a. være vedligeholdelse af hjemmesiden og udvikling af et afstemningsværktøj til fordeling af overskuddet. Start: Hur...

    €21 Average bid
    €21 Gns Bud
    1 bud
    Data Entry
    Udløbet left

    Typing , online form filling

    €10 - €29
    €10 - €29
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Make wordpresss site really really fast'

    €9 / hr Average bid
    €9 / hr Gns Bud
    8 bud
    english revise
    Udløbet left

    ps revising personal statememt revising

    €414 Average bid
    €414 Gns Bud
    19 bud

    ...----------------------- Tekst om opskrift: Eksempel: "The meal consist of one cheese and olive Focaccia premade (I bet you could also make your own). A square is made in the middle of the bread so there is space for two eggs. The combo is topped with bacon and cress which add freshness and color to the breakfast/brunch recipe. This Focaccia egg and bacon food recipe is focused on making it with speed. Therefore this recipe will also learn you how to make bacon in the microwave......." (and so on) ----------------------- Ingrediensliste: 1 x Cheese and olive Focaccia premade bread 2 x Eggs 1 x Mango ..... o.s.v. ----------------------- En liste af hvordan opskrift udføres. 1 - Først tager du 2 - Så gør du 3 - N&ari...

    €96 Average bid
    €96 Gns Bud
    1 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Translate website from english to italian'

    €35 / hr Average bid
    €35 / hr Gns Bud
    1 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Make wordpresss site really really fast'

    €6 / hr Average bid
    €6 / hr Gns Bud
    1 bud

    ok thank youxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €29 - €242
    €29 - €242
    0 bud

    ok thank youxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €145 - €145
    €145 - €145
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €147
    €18 - €147
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €69 Average bid
    €69 Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud
    private job
    Udløbet left

    private jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobv

    €1 / hr Average bid
    €1 / hr Gns Bud
    1 bud

    Picture editing for phone charger etc.

    €19 / hr Average bid
    €19 / hr Gns Bud
    1 bud
    Boligportal
    Udløbet left

    Hej - skal bruge en hjemmeside hvor singler med børn kan tilbyde at leje deres værelser ud til andre singler med børn. Målet er at det skal fungere som portal for singler som søger at tilbyde deres børn familieliv med andre børn uden dog at have en fast partner og selvfølgelig for at man ikke som single skal bo alene bare fordi man ikke har en partner og gerne vil have familieliv med ligesindede.

    €18 / hr Average bid
    €18 / hr Gns Bud
    8 bud

    Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)

    €29 - €242
    €29 - €242
    0 bud

    Tunne a linux server

    €145 - €145
    €145 - €145
    0 bud
    A good job
    Udløbet left

    Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)

    €145 - €145
    €145 - €145
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Dmonco job'

    €19 / hr Average bid
    €19 / hr Gns Bud
    1 bud

    Hvis du har brug for en hjemmeside, som er inden for den moderne rækkevidde, kan jeg tilbyde dig nogle fair priser for moderne hjemmesider. Normalt hvis du finder et reklamebureau og du har visse krav, kunne prisen eksempelvis være 30.000 kr. hvor jeg kan tilbyde jer det samme, måske endda meget bedre til f.eks. 10.000 ...nogle fair priser for moderne hjemmesider. Normalt hvis du finder et reklamebureau og du har visse krav, kunne prisen eksempelvis være 30.000 kr. hvor jeg kan tilbyde jer det samme, måske endda meget bedre til f.eks. 10.000 kr i stedet for. I kan se min portfolie på: Eller se mit nyeste færdige projekt på Kunden bestemmer selv om det skal være en fast pris vi kære med, el...

    €1776 Average bid
    €1776 Gns Bud
    3 bud
    job of pdf data
    Udløbet left

    im interested on the job of pdf data susyc87@ xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €145 Average bid
    €145 Gns Bud
    1 bud

    Jeg skal have lavet en Webshop, på et domæne jeg allerede er i besiddelse af. Det er vigtigt du kan opfylde ALLE krav hvis du byder på opgaven. Krav / Specs: Du skal acceptere en betalingsordning på ca. 500,- / md, dog kan det forventes at den hæves væsentligt nogen måneder efter. ... Sitet skal være SEO venligt, men der behøves ikke blive lavet noget videre SEO arbejde. Opgaven skal være færdig senest 15/2/14. Det skal naturligvis også være sådan at jeg selv kan uploade varer, som jeg har lokalt på lager. Der skal naturligvis integreres med en betalingsgateway, her tænker jeg det nok bliver Ewire, men det ligger ikke helt fast endnu. Der må ikke væ...

    €1851 Average bid
    €1851 Gns Bud
    15 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' English to Norwegian and Swedish'

    €10 / hr Average bid
    €10 / hr Gns Bud
    1 bud

    ...Entering the OTP back into the platform. These tasks are performed correctly. However, we need to enhance the script to: • Mimic human behavior to the highest degree. • Ensure that each session is unique, with no detectable trace linking tasks. • Operate with a unique fingerprint for each session to bypass advanced detection mechanisms. • Requirements: 1. Fingerprint Randomization: o Integrate browser fingerprinting tools or libraries to randomize fingerprints (e.g., canvas, WebGL, fonts, plugins, and user agents) for each session. o Ensure that each fingerprint is unique and cannot be linked to previous sessions. 2. Behavioral Humanization: o Implement random delays and variations in mouse movements, typing speed, and scrolling. o Introduce subt...

    €128 Average bid
    €128 Gns Bud
    60 bud

    ...Contact Form: A functional contact form so potential clients or employers can reach out to me. Blog Section (optional): A simple blog feature to post updates or share insights related to my field. SEO Optimization: Ensure the site is optimized for search engines to help it rank well. Social Media Integration: Links to my professional social media profiles (LinkedIn, GitHub, Instagram, etc.). Fast Loading Speed: The website should load quickly and efficiently. Content Management System (CMS): I’d prefer a CMS like WordPress, Webflow, or another easy-to-use platform so I can manage content after the site is built. Skills Needed: Experience in HTML, CSS, JavaScript, and modern web development frameworks. Familiarity with UI/UX design to create a visually appealing exper...

    €86 Average bid
    €86 Gns Bud
    49 bud

    I need an experienced video editor who can turn my gameplay footage into a fast-paced, effects-heavy YouTube video. I will provide reference videos to illustrate the style I'm looking for. Ideal skills and experience include: - Proficiency in video editing software (e.g., Adobe Premiere Pro, Final Cut Pro) - Ability to create engaging, high-energy edits - Experience with effects-heavy editing - Creative mindset - Attention to detail - Good understanding of pacing and rhythm in editing Please include links to similar projects you have done in your proposal.

    €9 - €15 / hr
    Forseglet
    €9 - €15 / hr
    20 bud

    I'm looking for an experienced English tutor to help improve my speaking skills. The focus will primarily be on casual conversations, so the ideal candidate should have a knack for creating comfortable, engaging, and interactive sessions. Skills and experience in teaching English as a second language, particularly at an intermediate level, will be highly valued. Please be prepared to share your teaching philosophy and methods, as well as any relevant qualifications or experience.

    €18 / hr Average bid
    €18 / hr Gns Bud
    4 bud

    I'm looking for a computer whiz with a knack for data typing jobs. The job primarily involves data entry from scanned documents, which can include both numerical and textual information. Ideal skills and experience for the job: - Proficient in data entry - Able to handle mixed data types (numerical and text) - Experienced in working with scanned documents, online database as well written documents. - High attention to detail - Fast and accurate typing skills

    €242 Average bid
    €242 Gns Bud
    97 bud

    ...important areas (e.g., faces) and preserve quality selectively. 5. Advanced Entropy Coding Implement arithmetic or context-adaptive binary arithmetic coding (CABAC) with optimizations. 6. Post-Processing Integrate AI-based upscaling (e.g., super-resolution) to restore visual quality after aggressive compression. >>>Step 5: Build the Core Phase 1: Develop a Prototype Use Python + FFmpeg/OpenCV for a fast prototype. Focus on implementing one or two innovations (e.g., custom transforms or ML-based motion estimation). Phase 2: Transition to High-Performance Code Rewrite critical components in C++ or Rust. Integrate GPU acceleration using CUDA (NVIDIA) or Metal (Apple). Phase 3: Create a Compression Pipeline A typical pipeline looks like this: Preprocessing: Frame filteri...

    €505 Average bid
    €505 Gns Bud
    34 bud

    I need a professional web designer to improve the user experience of my site. The main focus areas will be: - Optimising loading speed: The site currently has some latency issues that need to be resolved. - Enhancing interaction: The site features several interactive elements, such as forms and widgets. These need to be made more intuitive and engaging. The ideal candidate for this project should have a strong background in UX design, web optimisation and interactive web elements. A portfolio showcasing previous website redesigns will be highly advantageous. We have a themealready from Themeforest, so i need you to copy the data across, make sure everything works ok. ******** DO NOT CALL US ABOUT THIS OFFER *************

    €395 Average bid
    €395 Gns Bud
    239 bud

    I need an SEO expert who can optimize my entire website, particularly the product pages, to improve its ranking on search engines, especially Google. The goals are to enhance the site's visibility and drive more traffic to the product pages. Key Requirements: - An expert who can develop and implement a comprehensive SEO strategy that covers on-page, off-page, and technical SEO - Proven ability to significantly enhance search engine rankings - A track record of improving website visibility on Google Skills: - In-depth knowledge of SEO - Proficient in Digital Marketing - Expert in Google Analytics - Skilled in Content Optimization - Excellent in Keyword Research Specific focus areas include: - Technical SEO improvements: Site speed optimization, Mobile-friendly enhance...

    €39 Average bid
    €39 Gns Bud
    28 bud

    We are looking for a skilled freelancer to design and develop a WordPress website with a room booking plugin. The website should be fully bilingual (Arabic and English) and consist of up to 12 pages. The project requirements are as follows: Key Features: Room booking functionality with a plugin. Bilingual support (Arabic/English). Responsive and user-friendly design. SEO optimization for both languages. Integration with payment gateways for booking. Pages: Up to 12 pages, including Home, About, Services, Contact, and Booking. Additional Requirements: High-quality UI/UX design. Easy-to-manage backend for content updates. Integration of Google Analytics and social media links. SSL certificate setup for secure transactions. Timeline: Please specify the estimated time require...

    €147 Average bid
    €147 Gns Bud
    179 bud

    ... - Develop a responsive layout for mobile and desktop. - Implement a booking system with custom options for packages and add-ons. 3. **Payment Gateway Integration (15%)** - Integrate payment options like UPI, credit/debit cards, and wallets. - Test the payment flow for seamless transactions. 4. **Testing & Final Revisions (15%)** - Conduct testing for responsiveness, speed, and usability. - Make revisions based on feedback. 5. **Launch & Training (10%)** - Deploy the site to the live domain. - Provide documentation and basic training on how to update content. --- **Skills Required:** - Web Design & Development (WordPress, Custom CMS) - Booking System Integration - Payment Gateway Setup - UI/UX Design Expertise ...

    €104 Average bid
    €104 Gns Bud
    46 bud
    Animated Ad for Grocery App
    6 dage left
    Godkendt

    I'm seeking a skilled video producer and animator to create an engaging, animated advertisement for my grocery shopping app aimed at small towns. Key Focus: - The primary aim of the video is to promote the app's features, particularly the easy ordering process and fast delivery options. - The animation should be captivating and clearly illustrate the app's user-friendly interface and its competitive delivery speed. Ideal Candidates: - Proven experience in creating animated advertisements. - Prior work with app promotion is a plus. - Strong portfolio demonstrating creativity and understanding of conveying complex information in a simple, engaging manner.

    €70 Average bid
    €70 Gns Bud
    18 bud

    Are you passionate about crypto and skilled in Social Media Management (SMM) and graphic design? Join ...Of TON? A soon-to-launch Telegram mini-app focusing on airdrop farming, with plans to expand into a complete ecosystem. What We’re Looking For: - Expertise in crafting engaging daily social media posts. - Proficiency in creating high-quality graphics for social media. - Creativity and commitment to contributing to a growing project. What’s in it for you? - Be part of the core team in a fast-growing crypto project. - Potential to transition to full-time employment based on performance. - Opportunity to grow alongside the project as it evolves. If you’re ready to showcase your skills and collaborate with a passionate team, join us in building the ...

    €20 Average bid
    €20 Gns Bud
    38 bud

    I need a talented video editor who can transform my raw educational footage into engaging YouTube and Instagram content. The videos will typically range from 4 to 6 minutes. Your key responsibilities will include: - Crafting an energetic and dynamic edit that aligns with the tone of the footage - Implementing my specific color scheme throughout the video - Adding pop-up text animations at designated points in the video - Ensuring the final product is suitable for both YouTube and short-form platforms like Instagram Ideal candidates will be proficient in video editing software, have a strong visual sense, and experience with creating fast-paced, engaging edits. Please include your rate per video in your bid, alongside samples of your previous work that demonstrate your abili...

    €6 / hr Average bid
    €6 / hr Gns Bud
    34 bud

    ...postgraduate project. The purpose of the assessment is to identify and rate hoarseness in the samples. Key Aspects: - Assessment of 68 voice samples for hoarseness using GRBAS scale - Provide a score summary with comments for each sample The most critical aspect of this project is overall accuracy of the assessments. Given the nature of the project, consistency across samples is also important. While speed of assessment is not as critical, timely completion of the assessments before the project deadline of October 31, 2025 is essential. Compensation will range from Rs. 150-250 for each sample assessed, based on your level of experience. The status of 'Expert Consulatnt' will be given in the dissertation work of this project. If you're interested, please don'...

    €147 Average bid
    €147 Gns Bud
    7 bud

    I need a professional translator to convert an approximately 800-page Marathi chargesheet into English. This translation is critical for legal proceedings, so it must be accurate and clear. Key Details: - The document is roughly 800 pages long. - Standard legal terms are used throughout the document, so a translator with a strong understanding of common legal jargon will be beneficial. - The translation does not need to be certified, but it does need to be of a high quality suitable for legal review. Ideal candidates for this project should: - Have extensive experience in translation from Marathi to English. - Be familiar with legal terminology and documents. - Be able to deliver a meticulous and high-quality translation within a reasonable timeframe.

    €15 Average bid
    €15 Gns Bud
    45 bud

    I'm looking for a developer to create a job search webpage and a corresponding mobile app for both iOS and Android. The app and the webpage would feature job postings and job searching capabilities. Key Components: - Job Posting Webpage: Although the specifics weren't outlined, I'm open to suggestions. It would be great if you could incorporate features like job listings with filters, resume uploads, and employer profiles. - Mobile App: This needs to be cross-platform compatible, intuitive, and user-friendly. - User Accounts: The platform should accommodate account creation for both job seekers and employers. Ideal Skills: - Proficiency in cross-platform mobile app development. - Experience in creating job search platforms o...

    €20 Average bid
    €20 Gns Bud
    28 bud

    ...app akin to Uber Eats, and I need expert assistance across various domains. Key Areas of Assistance: - Business Planning: Crafting a solid business plan is crucial for securing funding and guiding the company's growth. - Marketing Strategy: I need a comprehensive marketing strategy to create brand awareness and attract both users and restaurants to the platform. - Operational Setup: Assistance with setting up the operational aspects of the business is essential. The Ideal Candidate: - Proven experience in the food industry, particularly in food delivery services. - Strong background in business planning, marketing, and operational setup. - Excellent understanding of the key features of a successful food delivery app, including a user-friendly interface, a fast...

    €226 Average bid
    €226 Gns Bud
    58 bud

    I am searching for a part-time online data entry job to help my family pay tuition fees. I am proficient in Microsoft Excel and Google Sheets, and I am willing to learn new tools as necessary. Ideal Skills: - Proficiency in Microsoft Excel and Google Sheets - Attention to detail - Ability to work independently - Good time management skills

    €234 Average bid
    €234 Gns Bud
    122 bud

    I'm looking for an intern to assist in developing a web application using Next.js. This is a fantastic opportunity to gain experience working with a cutting-edge technology stack and to contribute to a real-world project. Your primary responsibilities will include writing clean, efficient code, troubleshooting issues, and collaborating with our team to implement new feature...fantastic opportunity to gain experience working with a cutting-edge technology stack and to contribute to a real-world project. Your primary responsibilities will include writing clean, efficient code, troubleshooting issues, and collaborating with our team to implement new features. Ideal candidates will have a basic understanding of JavaScript and React, and a willingness to learn and grow in a fast-pac...

    €81 Average bid
    €81 Gns Bud
    22 bud

    ... The backend should fully writtin from zero. Main functions like user management live management devicr management firewall management. Isp lock asn lock etc also series and movies management and reseller management with subreseller management and dns assignmend there should be a server management part for auto install main server, auto install loadbalancers, reload balancers and main server , fast reload and remake main and balancers also possible to add multi dns on main and loadbalancers. There should be a function for inporting epg datas and also user bouquet management etc so basicly if you know how this panel is working then you can write up. Also if you have premade ready panel you can show It should also have transcode profiles to assign channels, and createe channels....

    €1025 Average bid
    €1025 Gns Bud
    108 bud