English typing line jobJobs
As discussed - https://www.freelancer.co.uk/users/l.php?url=https:%2F%%2Fspreadsheets%2Fd%2F1nvo-U4DoeBK9NABdqOfCxJbNtx_bi4WnXtMHP927g6c%2Fedit%23gid%3D1761056546&sig=ae833c357c401da5803eac26c4379dece68c67abae9ec432c793a35434f144d6 https://www.freelancer.co.uk/users/l.php?url=https:%2F%%2Fspreadsheets%2Fd%2F1Vx_gMQdOemUmfRwBzPqE7BboZ1cMAmMt_s3VpWeL9Lg%2Fedit%23gid%3D196274952&sig=9e09b8297dc882dbcd45060b5c05b3510f7d2bf0cac9cf1d98884e9d7cf791b9
Er du villig til at flytte og arbejde i et andet land? Vi venter på dig i Estland. Niveau: Indgangs...Dansk (flydende) og engelsk (mindst B1) Vi søger en flydende dansk sprogbruger (mundtligt og skriftligt) til at hjælpe med vores kundesupportopgaver hos kunder (dette er jobbet på stedet og kræver flytning). Engelskkundskaber (mindst B1) kræves, da uddannelsen, før du starter et job, er på engelsk. -Du bør være indehaver af pas i EU eller Schengen-zonen på grund af krav om flytning. -Du kan være på begynderniveau og uden tidligere joberfaring, det vigtigste er, at dine sprogkundskaber er flydende. -Dette job vil kræve en flytning til Estland. Vi tilbyder en betalt flytning og fa...
I like you to teach me online how to solve two issues with my homepage made in Yootheme. I imagene, that I/you share screen and you talk me though. I guess It will take around 1 hour. This is the homepage: This is the tasks that I need to have solved: 1) I like to have a Trustpilot logo on top of the video. Just like they do here: I have the trustpilologo in png format I have tried one suggested solution online, but then my Header also get transparent, I do not wish that. 2) I like to learn how to make one element, that I can copy to different location - but I only need to make changes one place. The element should have one "mother" so to speak. The four boxes on the front page with Begravelse, bistættelse, gør mere selv afsked og sig farvel på din m&arin...
Jeg har en 4 danske tekster som skal indlæses og optages i god kvalitet. Der er ca. 6-800 ord. Det skal bruges til en meditation og derfor er en rolig stemmeføring vigtig. Der er mange pauser i indlæsningen og hver tekst varer ca. 5-8 min. Female voice over for a meditation project. Calm and relaxed voice. The challenge is to make naturals breaks while reading the text.
...calculator plugin is needed is related to a lady who is a sexworker. If you have moral issues with this, then the job is not for you. I would like to encourage females to place a bid. Skills count for more than gender in the end, though. But women ROCK! ;) I will need something visual and/or clickable since I do not speak "tech" at all. It's like reading Mandarin or Swahili to me. Must work in the WP theme Astra. I can't provide link just yet to the Astra theme, since the developer is unavailable for a few days. We can buy the PRO version if needed. Go to The site is in danish, but the functions will be more or less the same. The job is ONLY for the price calculator with the green slider input, some variables as add-on choices with a preset defa...
mere paas laptop mere ko sab kuchh aata hai milega ki nahin
I have 40 films telugu and kannada
Hej, jeg vil gerne starte sådan et “clothing line” op, fordi siden jeg var lille, har jeg altid drømt om at designe tøj osv
I need a web page like this one: i want same functions, the same pages. same words. want to be able to change the ad boxes.
Database description Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit via CSS. The database must be a SQL database. Th...
...Værdi A - Giver valg 1,2,3 Værdi B - Giver valg 4,5,6 osv.. Har du selv en smart måde at lade brugeren vælge først en værdi og derefter de værdier der passer til den første værdi, så brug den :-) Disse to valgte værdier skal også med på udskriften som tekst. Man skal kunne vælge hvilken printer man vil bruge i en combo / dropdown box. Ved udskrift skal hver værdi skrive på hver sin line. HVER værdi skal skrive to gange lige underhinanden. Jeg skal kunne vælge to forskellige fonte i koden (ikke i GUI). Bare brug af de gængse. Det hele skal printes på en A4-side ved tryk på "Print"-knap. Bare funktionaliteten er i orden med...
ask for details..........................................................
Oversætte kærestebreve fra engelsk/dansk til kinesisk. Beskrivelsen er både på engelsk og dansk! Der er 5700 ord. Det skal helst være en være en oversætter, som har erfaring med oversættelse af romantisk og poetisk indhold! In English! Translating love letters from English / Danish to Chinese. The description is in both English and Danish! There are 5700 words. It should preferably be a be a translator who has experience with translation of romantic and poetic content!
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
...enforce corporation among the units. Custom protocols should be fully documented using relevant sequence diagrams and FSMs. - A “web based” interface to the users account on the central server. Users should be able to register, login and manage their information – as well as view statistics on recent journeys. - You might implement a manager role that can view statistics about a particular bus/train line or multiple users. Servers and train computers should be located on our virtual servers (“Goonhilly” / “The Lizard” ) and use relevant DBMSs – either PostgreSQL, mySQL or SQLite. It is however acceptable to use a number of a team’s portable computers as train computers. The prototype should focus and demonstrate the pot...
...enforce corporation among the units. Custom protocols should be fully documented using relevant sequence diagrams and FSMs. - A “web based” interface to the users account on the central server. Users should be able to register, login and manage their information – as well as view statistics on recent journeys. - You might implement a manager role that can view statistics about a particular bus/train line or multiple users. Servers and train computers should be located on our virtual servers (“Goonhilly” / “The Lizard” ) and use relevant DBMSs – either PostgreSQL, mySQL or SQLite. It is however acceptable to use a number of a team’s portable computers as train computers. The prototype should focus and demonstrate the pot...
software job xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Jeg kan ikke komme ind i WP, får denne besked: Fatal error: Call-time pass-by-reference has been removed in /var/www/ on line 21
Write articles for me xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
i can design Wordpress on Template , code on teamplate ,ex: ://://
...søger en freelancer der kan skrive nogen artikler til min blog. Bloggen er på engelsk og indeholder madopskrifter. Artiklerne skal være unikke og 600+ karakterer lange pr. blog artikel. Opskrifternes og dets søgeord vælger du selv, det eneste krav er at de er valgt omhyggeligt så der kommer flere besøgende til siden. Eksempel på hvordan teksten ønskes udformet: ----------------------- One line appetitvækker: Eksempel: "Quick and delicious breakfast/brunch that lets you impress the people you serve it for" ----------------------- Tekst om opskrift: Eksempel: "The meal consist of one cheese and olive Focaccia premade (I bet you could also make your own). A square is made in the middle of t...
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Translate website from english to italian'
ok thank youxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ok thank youxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
private jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobprivate jobv
Picture editing for phone charger etc.
Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)
Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)
TO RECEIVE THE PROJECTS, GO TO MY COMPANIES INSTAGRAM at enamorarseapparel... ONLY THE BEST WILL GET HIRED!
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Dmonco job'
im interested on the job of pdf data susyc87@ xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' English to Norwegian and Swedish'
...advanced detection mechanisms. • Requirements: 1. Fingerprint Randomization: o Integrate browser fingerprinting tools or libraries to randomize fingerprints (e.g., canvas, WebGL, fonts, plugins, and user agents) for each session. o Ensure that each fingerprint is unique and cannot be linked to previous sessions. 2. Behavioral Humanization: o Implement random delays and variations in mouse movements, typing speed, and scrolling. o Introduce subtle "human-like" errors, such as mistyping and correcting inputs. o 3. Cookie and Cache Management: o Clear cookies and cache between sessions to remove residual data. o Randomize storage settings, including local storage and IndexedDB, for further anonymity. o 4. Anti-Bot Evasion: o Integrate tools such as Puppeteer Stealth o...
We are looking for a skilled designer to create a detailed render of an innovative automated 3D printing production line. The render should visually represent a seamless workflow for an advanced SLS 3D printing system, incorporating automated material recycling, robotic classification, and finishing processes. This project aims to showcase the efficiency, sustainability, and advanced automation of our concept. The final render will be used to present the system to stakeholders and visualize its potential in a modern manufacturing environment. Workflow Overview: The concept centers around a 3D printing farm equipped with SLS 3D printers featuring build chambers of approximately 165 mm x 165 mm x 300 mm. The proposed workflow is as follows: Build Chamber Removal: An operator remo...
I'm looking for an experienced English tutor to help improve my speaking skills. The focus will primarily be on casual conversations, so the ideal candidate should have a knack for creating comfortable, engaging, and interactive sessions. Skills and experience in teaching English as a second language, particularly at an intermediate level, will be highly valued. Please be prepared to share your teaching philosophy and methods, as well as any relevant qualifications or experience.
