Effects of media on societyJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 effects of media on society jobs fundet

    /findtranscript/ error.. pls fix

    PHP
    €19 Average bid
    €19 Gns Bud
    17 bud

    poster for online posts 3 pictures Bold

    €21 Average bid
    €21 Gns Bud
    13 bud

    Hey, Can you please estimate your best price for SEO on my homepage. 1. My homepage: We work with personal finance and bookkeeping. 2. Key Words/ discription •Personal finance: Keywords: privatøkonomi, uvildig rådgivning, gæld, økonomisk rådgivning Discription: rådgivning om gæld, økonomisk rådgivning til private og virksomheder •Bookkeeping Keywords: bogføring, regnskab, skat, moms Discription: bogføring til billig fast pris, selvangivelse og moms, 3. Competitors •Personal finance: 1. 2. 3. •Bookkeeping: 1. 2. 3. If you need any other information, do not hesitate to contact me. Best regards Wasim R.

    €741 Average bid
    €741 Gns Bud
    1 bud

    Innovatives Design, agile Interaktion, Blog, Media

    €474 Average bid
    €474 Gns Bud
    20 bud

    blog posting like SEO,DESIGNING,SOCIAL MEDIA,TECHNOLOGY

    €419 Average bid
    €419 Gns Bud
    19 bud

    Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

    €148 - €445
    €148 - €445
    0 bud

    Design a Banner for my Social Media III Design a Banner for my Social Media III Design a Banner for my Social Media III Design a Banner for my Social Media III Design a Banner for my Social Media III Design a Banner for my Social Media III Design a Banner for my Social Media III Design a Banner for my Social Media III

    €11 Average bid
    €11 Gns Bud
    2 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €148
    €18 - €148
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud

    im looking for an estimate on creating a cad drawing of the ring that i uploaded

    €29 - €244
    €29 - €244
    0 bud

    Internet Marketing. Internet Marketing. Internet Marketing. Internet Marketing. Internet Marketing. Internet Marketing.

    €12 / hr Average bid
    €12 / hr Gns Bud
    1 bud

    OUR COMPANY IS LOOKING FOR SKILLED INTERNET POSTING EXPERTS WHO CAN POST ON USA CLASSIFIEDS SITE INTERESTED PERSONS SHOULD CONTACT US AS SOON AS POSSIBLE THROUGH OUR SKYPE WHICH IS [Removed by Freelancer.com Admin]

    €244 - €731
    €244 - €731
    0 bud

    As per skype conference

    €439 Average bid
    €439 Gns Bud
    1 bud

    Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...

    €390 Average bid
    €390 Gns Bud
    5 bud

    This project delves into the fascinating intersection of behavioral finance and data science. We aim to analyze ptivided data through the lens of investor psychology, identifying behavioral biases and sentiment drivers that influence market trends. Using R and statistical modeling, we will examine historical market data, news sentiment, and social media trends to develop predictive models of market movements. This project offers a unique opportunity to contribute to a cutting-edge research initiative with real-world applications in investment strategy and risk management. Key Deliverables: Quantitative analysis of market data and investor behavior. Development of predictive models incorporating behavioral finance insights. Comprehensive report wi...

    €233 Average bid
    €233 Gns Bud
    10 bud

    I'm in the process of starting a new enterprise and urgently require an experienced marketer to help me advertise my company across various websites and online public groups. Key Duties: - Manage advertising on social media platforms and online forums. - Drive visibility and engagement with potential customers. Desirable Skills & Experience: - Proven experience advertising online. - Able to work quickly, with the capacity to start immediately. - Expertise in using social media and online forums for advertising purposes. - Excellent understanding of online audiences and web trends. Please make sure your bid includes a brief breakdown of your relevant experience and skills. As timing is crucial for this project, indicate your availabili...

    €54 Average bid
    €54 Gns Bud
    4 bud

    I'm in need of a professional who can create modern and sleek banner ads for my credit card selling website, with the intent to also display these ads across various social media platforms. Key Requirements: - Design and creation of engaging banner ads tailored for credit card sales - Ads should adhere to a modern and sleek design aesthetic - Ability to create ads suitable for both my website and social media platforms Ideal Skills and Experience: - Proven experience in designing banner ads - Strong understanding of credit card sales promotion - Ability to design within a specific style - Experience with social media ad placement I'm looking for someone who can bring creativity and professionalism to this project, helping drive traffi...

    €59 Average bid
    €59 Gns Bud
    17 bud

    ... DEADLINE: MONDAY 11:00 p.m. (CET) Instructions: -You have to make IMPROVEMENTS on the lighting and texture/materials of breakfast food items and make it more realistc -LIGHTING using PXR RENDERMAN - SIMPLE SHADING for some objects and ADV SHADING for those on which you want to add detail by SHADING with textures, MUST BE ALL IN PROCEDURAL - I have done this already just tweak the amount of specular, texture, glass, e.t.c in hypershade. - I HAVE ALREADY DONE THE MODELING and the LIGHTING/COLOR. I will provide you the maya file to make IMPROVEMENTS of the original. -There are some elements I want you to change color/material on to make more realistic for e.g the crossiant, baguette, maple syrup on the pancake, fruits, the table y...

    €209 Average bid
    €209 Gns Bud
    5 bud

    I'm seeking a developer who can create a Google Chrome web extension to scrape mobile numbers from various sources such as web pages, social media profiles, and databases. The extension should also be equipped with the following features: - Data Export: The ability to export the scraped data to a CSV file. - Automated Data Cleaning: The extension should have a feature for automating the cleaning of the scraped data. Ideal candidates should have prior experience in developing web extensions and should be adept at data scraping. Knowledge of data cleaning techniques will be an added advantage.

    €174 Average bid
    €174 Gns Bud
    7 bud

    I'm seeking an expert in OneDrive who can assist me in setting up file backup from my Windows laptop to OneDrive. I have one drive and google drive installed but now confused what is being saved and backed up where? The primary purpose of this project is to ensure that all relevant files from my laptop and Android phone are securely backed up. Key tasks: - Set up OneDrive on my laptop for backup purposes. - Configure the system to back up files from both my laptop and Android phone. - Ensure the backup process is efficient and comprehensive. Ideal skills and experience: - Proven expertise in using Microsoft OneDrive. - Familiarity with Windows operating system and Android devices.( I have a samsung S21 and a Dell laptop) - Experience in setting up file backup systems....

    €171 Average bid
    €171 Gns Bud
    18 bud

    I'm seeking a creative video editor to help craft engaging, fast-paced Ins...seeking a creative video editor to help craft engaging, fast-paced Instagram Reels for my brand, PepperDeer. We're a premium brand focused on quality, natural ingredients, and farmer upliftment. Key Responsibilities: - Crafting short-form content with a narrative-driven approach - Innovating dynamic video transitions, text overlays, and color grading - Synchronizing music for maximum impact The ideal candidate will have a passion for storytelling, a sharp eye for detail, and experience creating captivating social media content. A fresh and creative perspective to bring our brand narrative to life is essential. Please share your portfolio or samples of previous work when responding...

    €78 Average bid
    €78 Gns Bud
    8 bud

    I'm looking for an experienced video editor who can bring a fun a...bring a fun and playful style to my YouTube videos. The ideal freelancer will have a knack for creating advanced effects and transitions, particularly with text and titles and motion graphics. This will be for the YouTube channel 'Erin Nash'. Key requirements: - Proficiency in advanced video editing techniques - Experience with creating engaging motion graphics - Ability to edit text and titles in a fun and playful way - A keen understanding of pacing and rhythm for YouTube content Skills in colou r correction and grading would be a plus, but the main focus will be on creating an enjoyable viewing experience through creative editing and transitions. Please provide examples of ...

    €16 / hr Average bid
    €16 / hr Gns Bud
    29 bud

    As the owner of a clothing company, I'm in need of a professional who can create modern clothing designs for my brand and also manage my Instagram marketing with posts made from media I provide. Key Responsibilities: - Create unique and appealing modern clothing designs. - Develop engaging Instagram posts from provided media. - Understands and can apply current social media trends and marketing strategies. Ideal Candidate: - Proven experience in clothing design. - Strong understanding of Instagram marketing. - Capable of creating visually appealing social media content. - Familiar with modern design aesthetics.

    €7 / hr Average bid
    €7 / hr Gns Bud
    34 bud

    I'm in the process of starting a new enterprise and urgently require an experienced marketer to help me advertise my company across various websites and online public groups. Key Duties: - Manage advertising on social media platforms and online forums. - Drive visibility and engagement with potential customers. Desirable Skills & Experience: - Proven experience advertising online. - Able to work quickly, with the capacity to start immediately. - Expertise in using social media and online forums for advertising purposes. - Excellent understanding of online audiences and web trends. Please make sure your bid includes a brief breakdown of your relevant experience and skills. As timing is crucial for this project, indicate your availabili...

    €124 Average bid
    €124 Gns Bud
    4 bud

    I'm in need of an expert who can build a full-fledged affiliate program website for me, accompanied by a blog focused on product reviews. This project also includes creating social media pages and endorsing them via Google Adwords. - Website Requirements: - The site should have a fully functional affiliate program with tracking & analytics, referral links, and commission management. - Blog Requirements: - The blog should be managed with daily trending content, images, and product reviews to keep it engaging and high-ranking. - Using AI for posting and sourcing content is essential. - Social Media: - Creation of Facebook, Instagram, and Twitter pages is required. Timeframe: The entire project needs to be completed within 7 da...

    €147 Average bid
    €147 Gns Bud
    63 bud

    I'm seeking a skilled digital marketer to help attract clients to our forex signal service. The ideal candidate should have expertise in: - Social Media Marketing: Primarily on Facebook, Instagram, and LinkedIn. - Email Marketing: Crafting and executing effective campaigns to generate interest and conversions. Understanding of forex market and signals will be an added advantage.

    €141 - €424
    €141 - €424
    0 bud

    Innovative Business Ideas for Budding Entrepreneurs Starting a business could be one of the most fulfilling and rewarding journeys. Be it trying to solve a problem, creating value, or making people financially independent, the right choice of business idea plays an important role. The following are some innovative ideas that entrepreneurs can take up to leave their mark in the world of business: 1. E-commerce of Niche Products E-commerce will continue to grow, but success usually occurs when targeting a niche market. Selling a product that a particular audience would want-for instance, handmade products, eco-friendly products, or fashion items that are a little different-can make your business stand out. It's never been easier to get your online store u...

    €1036 Average bid
    €1036 Gns Bud
    26 bud

    I'm seeking a minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and vivid, so it should pop and be visua...sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and vivid, so it should pop and be visually engaging. Key Requirements: - Animation should have a minimalist design - Use of a bright and vivid color palette - Customization of the poker chips with my provided logo in the middle area Ideal Skills and Experience: - Proficient in creating WebM animations - Strong understanding of minimalist design principles - Experience with logo and patte...

    €110 Average bid
    €110 Gns Bud
    14 bud

    My Digital Ocean droplet, which hosts a web application, has stopped responding after a restart. I suspect a network issue. It’s crucial to get this fixed ASAP. Ideal Skills: - Experience with Digital Ocean droplets - Networking troubleshooting - Web application hosting - Server management Please reach out if you can assist. Bid if you can start working immediately

    €25 Average bid
    €25 Gns Bud
    12 bud

    I am working on a research project for AI-based early detection of congenital heart defects (CHDs) using a 12,000-labeled echocardiogram dataset. I need an experienced freelancer to completely build and train models using Convolutional Neural Networks (CNNs) and Generative Adversarial Networks (GANs) to achieve accurate and reliable results. The task involves: Preprocessing: Augmentation and cleaning of the dataset. Model Development: Building and training a GAN-CNN hybrid model for CHD detection. Validation: Testing and validating the model to generate results, including metrics like accuracy, sensitivity, and specificity. Deliverables: Fully functional code (Python/TensorFlow/Keras, Google Colab preferred). Final results and visualizations (accuracy metrics, confus...

    €33 / hr Average bid
    €33 / hr Gns Bud
    58 bud

    I'm looking for a skilled social media manager to elevate the online presence of my butcher shop. Your tasks will include creating a new Facebook page, managing our Instagram, and posting 2 to 3 times a week. Key Responsibilities: - Content Creation: Focus on promotions and discounts, along with recipes and cooking tips. - Customer Engagement: Foster interaction through Q&A sessions. - SEO Optimisation: Enhance our Google presence. - Design Work: Create eye-catching posters for shop specials. I'm open to your expertise, but I have some ideas we can work on together for branding. If you have experience in social media management, customer engagement, and content creation, particularly in the food industry, I would love to hear from you. Co...

    €212 Average bid
    €212 Gns Bud
    58 bud

    I need a skilled video editor to enhance our marketing content for YouTube. The ideal freelancer should have a strong understanding of video editing techniques that are effective for social media platforms, particularly YouTube. Key Requirements: - Proficient in video editing software - Previous experience editing marketing videos - Understanding of YouTube's video style and audience - Able to deliver engaging content that aligns with our brand Please provide examples of your past work, particularly any that has been used for YouTube.

    €17 Average bid
    €17 Gns Bud
    17 bud

    ...von eingehenden Nachrichten und aktive Interaktion mit der Community (z. B. über Kommentare, Direct Messages). - Tools: Optionaler Einsatz von Tools wie ManyChat zur Automatisierung. - Design: Optional Gestaltung von Posts und Stories mit Canva oder ähnlichen Tools. Dein Profil: - Deutsche/r Muttersprachler/in oder sehr gute Deutschkenntnisse in Wort und Schrift. - Erfahrung im Social Media Management, insbesondere Instagram. - Kreativer Schreibstil und ein Gespür für ansprechende visuelle Inhalte. - Verlässlichkeit und eigenständige Arbeitsweise. - Idealerweise Erfahrung im Bereich Abnehmen, Ernährung, Gesundheit oder verwandten Themen. - evtl. Erfahrung in Schaltung von Instagram Ads Was dich erwartet: - Langfristige Zusa...

    €13 / hr Average bid
    €13 / hr Gns Bud
    6 bud

    I'm looking for a developer to ...interactive page using Unity3D. We have bought a teeth & mouth model and we want to put it in a unity3d project. Key Requirements: - need to allow users to click on any teeth and then display / change color of selected teeth. Then allow users to click buttons "Add comment" & "Hide Teeth". - Trigger a javascript function if user clicks add comment. Send what teeth is selected on javascript web (ReactJS / Angular JS / any JS). - Hide the selected teeth and trigger a javascript function if user clicks Hide Teeth. Send what teeth is hidden on javascript web (ReactJS / Angular JS / any JS). - Allow dragging to rotate and little zooming on the 3d object. Final Files: 1. Unity3D Proj...

    €156 Average bid
    €156 Gns Bud
    22 bud

    ...dining experience. The name "Cabinett" evokes a sense of curated quality—a place where every meal is crafted with care and flavor in mind. The brand aims to combine fun and sophistication, appealing to food lovers of all ages. Logo Design Elements: Typography: A bold and modern sans-serif font to convey energy and approachability, with playful accents or custom lettering that give it a freestyle twist. Color Palette: Primary Colors: Warm red or orange tones to evoke appetite and excitement. Secondary Colors: Black or charcoal for a sleek, modern touch, paired with creamy beige to symbolize fresh bread and warmth. Symbol/Icon: A fun, minimalistic burger and pizza slice crossed like a crest or arranged inside a circle to create a "seal of qualit...

    €20 Average bid
    Garanteret
    €20
    319 indlæg

    ...in need of a well-connected individual who have family and friends in Canberra. My goal is to inform potential food delivery drivers about a new food delivery app launching in their city. Key Responsibilities: - Communicate the details of a new food delivery app to your family and friends who are currently doing food delivery in Canberra - Utilize various communication methods including social media, in-person discussions, and phone or messaging - Regularly follow up with your network about the app Ideal Skills and Experience: - Strong interpersonal communication skills - Extensive network of family and friends in Canberra - Experience in food delivery or knowledge about the food delivery industry is a plus - Active social media presence The goal i...

    €21 Average bid
    €21 Gns Bud
    3 bud

    I'...will be building excitement and a list of pre-interest in ordering the Book. Key Responsibilities: - Develop a visually appealing and engaging Book launch campaign, social media, LinkedIn. - Create and curate images, graphics and narrative that align with book's themes and target audience - Strategize on optimal posting times and frequency for maximum reach - Build a way for people to register their interest and pre order Book. Skills: - Proficiency in graphic design and social media marketing - Experience in book promotion is a plus - Ability to understand and target specific audience demographics - Experienced marketer - Facebook, LinkedIn Ads Please note that while I have not specified particular social media platforms, the primary fo...

    €86 Average bid
    €86 Gns Bud
    29 bud

    I'm in need of a data-savvy individual who can help me collect and augment contact information. The data will primarily be sourced from Google. Key Responsibilities: - Starting with 1220 company contact records, research/augment/verify 16 data fields Contact First Name Contact Last Name Contact Title Contact Email Contact Phone Contact LinkedIn URL Org Facebook Org Instagram Org LinkedIn Address Line 1 Address Line 2 City State Zip Org Phone Number Web Address - Search for contact details including Email addresses, Phone numbers, Mailing addresses, Company LinkedIn URLs, Website URLs, Company Instagram URLs, Company Facebook URLs, and Executive LinkedIn URLs --Contacts with Job titles of CEO, President, CFO, Finance, Development Director, Advancement Director, Fundrais...

    €140 Average bid
    Fremhævet Haster
    €140 Gns Bud
    29 bud

    I'm looking for an expert to help me configure my Google Tag Manager (GTM) with Google Ads, Facebook Ads, and GA4. I need to track conversions specifically from two embedd...me configure my Google Tag Manager (GTM) with Google Ads, Facebook Ads, and GA4. I need to track conversions specifically from two embedded HubSpot forms, as well as gather data on lead sources flowing into HubSpot. Key Requirements: - Set up tracking for form submissions and page views. - Ensure data on lead sources from social media, search engines, and email campaigns is accurately captured and flows into HubSpot. Ideal Skills: - Proficiency with GTM, Google Ads, Facebook Ads, and GA4. - Experience with conversion tracking and HubSpot. - Excellent understanding of data flow and l...

    €93 Average bid
    €93 Gns Bud
    21 bud

    I'm seeking a researcher for writing a paper on "Role of ESG Criteria in influencing Financial Decision-making". The paper already has introduction written and sources collected. The final wordcount should be more than 10,000 words. Key Requirements: - Mixed-methods research approach, with a focus on academic journals. - Emphasis on all aspects of ESG criteria: environmental impact, social responsibility, and governance. - Data collection and Excel calculations as necessary. Prefer someone with a background in economics or finance. The project is low-stress with a requirement of around 1500 words per week. note, strict adherence to NO AI use mandatory. Minimal use of AI for guidance is acceptable, but no AI-generated conte...

    €39 Average bid
    €39 Gns Bud
    15 bud

    ...meme coins and identify trending new coins, automatically posting actionable insights to social media (e.g., Twitter). The page will function similarly to , tailored specifically for the Solana ecosystem and meme coin community. For example, it will generate real-time updates such as: "? Whale Alert: Whale X just bought 1M $SAMO for 50,000 SOL!" or "? Trendy Token: $NEWCOIN is gaining traction with 3 whales buying in the last 24 hours!" and "? Whale Movement: Whale Y swapped 500,000 $SAMO for $SOL in a major trade!" The project will involve creating an automated system that tracks whale wallets via Solana RPC or Solscan API, identifies new meme coins gaining traction on DEXs like Raydium, and posts engaging updates using the Twitter API. The ...

    €3936 Average bid
    €3936 Gns Bud
    14 bud

    I'm seeking a video editor for some personal/event footage. The editing style should be casual and natural. Key Editing Components: - Transitions and effects - Text and titles - Music synchronization Ideal candidates should have: - Prior experience in editing personal or event footage - Strong understanding of casual and natural editing styles - Proficiency in applying all types of edits, as listed above - Ability to enhance the video in a fun and engaging way without making it overly polished or cinematic.

    €15 Average bid
    €15 Gns Bud
    18 bud

    I'm looking to enhance my social presence on Facebook and I need someone who can help me buy friend requests. Key requirements: - The friend requests should come from all age groups, 18-44. - The geographical location of these requests should be global. Ideal skills: - Experience in social media management. - Understanding of Facebook's friend request system. - Ability to source friend requests from diverse demographics. Please note, this project is solely for increasing my social presence, not for promoting any business or brand.

    €12 Average bid
    €12 Gns Bud
    13 bud

    ...responsible for creating and posting 2-3 engaging videos daily on our Instagram page, providing valuable market insights, updates, and knowledge to our audience. Responsibilities: Research content related to the women fitness and generate reels idea Create 2-3 short and engaging videos daily (30-90 seconds each) with accurate information.(Video will be created by the owner based on the ideas). Selected person has to edit the video. Use graphics, charts, and animations to make the videos visually appealing. Add captions, subtitles, and appropriate hashtags for maximum reach. Post the videos on our Instagram page at optimal times. Respond to comments and engage with the audience if needed. Requirements: Strong understanding of the Instagram Uses and Insta...

    €126 Average bid
    €126 Gns Bud
    16 bud
    Buy Facebook Page Feedback
    6 dage left
    Godkendt

    I'm looking to enhance the credibility of my Facebook page, gain valuable user insights, and boost engagement metrics. A key part of this strategy is acquiring 101-200 positive reviews to give my page a significant boost. The ideal freelancer for this project should have: - Proven experience in social media marketing - Strong understanding of Facebook's algorithms and engagement strategies - Capable of sourcing genuine and positive feedback to enhance the page's credibility. The ultimate goal is to make my page more appealing to potential followers and customers.

    €16 Average bid
    €16 Gns Bud
    8 bud

    I want to develop an animated series which concentrates on "how to make India a developed country". Trailer: In 1700 India was holding 27% of world economy. 200 years later India's share dropped to less than 3%. Why? Because British came and demolished India's native institutions. 1) Its economy deindustrialized 2) Its trade networks got destroyed 3) Its people got deeply divided by caste and creed. In just 200years India was turned from richest country to developing country. It is 21st century, still we are said as a developing country. Here comes KALAM who tells us in each episode one idea how to turn India to a developed country. Hold on to watch more ..................trailer ends I need someone to help me with the script for this traile...

    €11 / hr Average bid
    €11 / hr Gns Bud
    6 bud

    I am seeking a talented creative writer with a knack for crafting captivating romance narratives. Your primary task will be to create engaging storylines that resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narrati...resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narratives. - Ability to understand and cater to an adult audience. Your creative storytelling will not only entertain but also draw readers into the beautiful complexities of...

    €19 / hr Average bid
    €19 / hr Gns Bud
    12 bud