Disadvantages of bill of materialsJobs
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm seeking a professional operator to help load and unload a heavy truck with a telehandler. The items include construction materials, some of which are very heavy and require special handling. Key Responsibilities: - Telehandler operator experience This project requires experience loading trucks and handling construction materials; please include your relevant experience and equipment in your bid.
I am looking for a developer to create an Android application designed for android tablets, which will be installed in taxis. The applicat...passengers. • It must operate seamlessly in a taxi environment, considering limited supervision. Deliverables: • A fully functional application with the described features. • Clear documentation for setup and operation. • Remote management capabilities for ads and quizzes. • (Optional) Implementation of the battery optimization software. The developer must be available for ongoing communication in case of technical issues. After a longer period of cooperation, the developer will, of course, be rewarded additionally. If you have any questions or need additional details, feel free to reach ou...
I will be contacting ONLY people who read the attached PDF file if you are interested in this job you have to have a look at the PDF file first
... and other materials that engage our audience and promote accuracy. Candidates must have excellent writing skills, along with a strong understanding of grammar and syntax and the ability to work independently to meet deadlines. Project Description We are partnering with one of India’s fastest-growing Ed-Tech startups on a year-long content-building project. The company is on a mission to bridge the gap between industry and academia by equipping individuals with industry-relevant skills. Their offerings include programs for students right after Intermediate/12th grade to secure high-paying tech jobs and courses for aspiring professionals to become skilled software developers through a proven curriculum. Recognized by prestigious institutions such as NSDC (un...
I'm looking for a medium-sized (3-4 feet) dragon, made entirely of donuts, that can articulate in a highly detailed and flexible manner. This unique piece is meant to be a gift, so the overall quality and presentation must be exceptional. Ideal Skills: - Advanced sculpture and modeling experience - Expertise in creating movable, intricate designs - Experience with food-safe materials and crafting Please note that this project requires a high level of creativity and craftsmanship. The dragon must not only be visually impressive, but also functionally articulate in a complex, flexible manner.
I require a specialist to utilize COMSO...design (air and water) as a baseline - Optimizing the design to assess the impact of different materials and pipe diameters - Considering various types of flow and pipe configurations, such as dimpled and smooth pipes - Focusing on the specific demands of CPB machines for blood warming and cooling The ideal candidate will have: - Extensive experience with COMSOL and heat exchanger design - A deep understanding of fluid dynamics, particularly in relation to blood and water - Knowledge of different materials and their suitability for this application - Ability to provide expert advice on flow types and pipe configurations Ultimately, I am looking for a comprehensive and efficient design that meets th...
...expertise in custom theme development. The candidate needs to be available immediately for at least 8h of continuous work. Specific requirements for this project include: - Custom theme development for Shopify and Wordpress - Familiarity with app development for Shopify & plugins for wordpress - Store setup and configuration - INSTANT communication availability (as we have only teamwork-based tasks, not work-at-your-own-pace). Only individual freelancers please, no teams/agencies. In order to separate spammers from real candidates, if you agree with this statement please write it on top of your bid: "I am available to work immediately and have X hours left available TODAY!" - where "X" is the amount of hours you have available for work tod...
I run a badminton court business and I'm in need of a professional designer who can create an eye-catching, promotional banner for outdoor display near the venue. Key Elements to Include: - Our business name and logo - Contact details and address - Special offers and promotions The ideal candidate should have experience in designing outdoor promotional materials, understanding of how to attract potential customers and ability to deliver high-quality, durable designs suitable for outdoor conditions.
I am seeking multiple motivated lead generators and appointment setters for a pay-per-meeting role, with an attractive OTE of $1500/month for the right candidates. Your main task will involve targeting commercial properties in the U.S. that have parking spaces and may be interested in installing EV Chargers using government funding. Key Responsibilities: - Cold calling businesses from Google Maps using our provided dialer - Engaging in meaningful dialogues with potential clients - Utilizing our provided scripts that is proved to work and our most-common objection guide that is already proven to answer to the most common questions our clients will ask you. Ideal Candidate Qualities: - Exceptional ability to handle objections - Proactive and takes initiative - Excellent communica...
Catalog should cover, Custom graphics, Table for dimen...explain product details, Showing product picture in details and illustrative way. I'm seeking a professional graphic designer to create a 4-5 page corporate brochure. The brochure's purpose is to appeal to potential clients and encourage them to request a quote. Key Requirements: - Proficiency in design software (Adobe InDesign, Illustrator, etc.) - Experience in creating corporate materials - Excellent understanding of visual communication and branding - Ability to translate catalog details from a provided document into a visually appealing and professional design Your design will need to balance professionalism with approachability, clearly presenting our company's offerings in a way that encourage...
I'm seeking a designer to create letterheads, flyers, deal sheets, and an Instagram deal post template for my brand. The design should be: - Modern: The style should reflect a ...designer to create letterheads, flyers, deal sheets, and an Instagram deal post template for my brand. The design should be: - Modern: The style should reflect a contemporary, sleek design. - Focused on Product/Service Sales: The materials will primarily be aimed at promoting my products/services, so they should be persuasive and commercially appealing. - Using Corporate Colors: All designs should align with and incorporate my corporate color scheme. Ideal candidates would have: - A strong portfolio in modern design - Experience in creating sales-oriented materials - Ability to work with co...
I'm in need of a talented graphic designer proficient in both poster and video editing. The primary focus will be creating materials for a marketing campaign. Key Responsibilities: - Design and edit engaging posters - Create and edit captivating videos Skills and Experience Required: - Exceptional graphic design skills - Proficiency in both poster and video editing - Experience in creating materials for marketing campaigns Please note, I do not have existing branding guidelines, so creativity and the ability to think outside the box is key. I'm looking for someone who can help bring this project to life.
Project Description: Looking for a developer or team to create an app similar to Linktree, enabling users to organize and share links with customization options and analytics. Key Features: User Profiles: Create profiles with photo, name, and description. Add and organize custom links. Customization: Basic themes for profile design. Tools to edit colors, fonts, and layout. Analytics: Track clicks and link views. Provide basic reports for users. Premium Plan: Exclusive templates and advanced analytics. Custom domain support (e.g., ""). Technical Requirements: Frontend: React Native or similar hybrid solutions for iOS and Android. Backend: Node.js or Django with scalable API. Database: Firebase, MongoDB, or PostgreSQL. Analytics Integration: Google Analytics or custom soluti...
...address the core needs of our team while allowing for future enhancements. Here’s a breakdown of key components: Core Features 1. Project Dashboard: o Overview of all active projects with status indicators. o Key metrics like budget, timeline, and completion percentage. 2. Schedule Management: o Ability to create, assign, link and track tasks. o Simple board or list view to manage tasks visually. o Gantt view capabilities 3. Document Management: o Project specific storage for important documents (plans, contracts, permits). o Basic version control and search functionality. 4. Communication Tools: o Integrated messaging or comments for team collaboration. o Notifications for task updates or comments. 5. Budget Tracking: o Basic expense logging with categories...
I'm in need of an elegant and modern flyer for the opening of my photo studio. The event is scheduled for March 1st, 2025 at 10am. The design should be predominantly in black and white, with the following critical information highlighted: - Types of photography services offered - Contact details The flyer should reflect a sophisticated, elegant design aesthetic. It should be able to capture the attention of potential clientele and convey the quality and style of the services provided by the studio. The ideal freelancer for this project should have a strong background in graphic design, particularly in creating event promotional materials. Experience with designing in an elegant style and working with a monochrome palette will be highly adva...
I am fluent in Turkish and seeking opportunities in the Turkish language sphere, specifically in the Business and Commerce sector. - Types of Work: I'm open to any Turkish language-related work, whether it's translation services, tutoring, teaching, or content writing and editing. - Translation Content: I can handle the translation of any type of content, be it legal documents, technical manuals, or marketing materials. Given my proficiency in Turkish, I am eager to leverage my language skills in a dynamic and challenging environment. Ideal candidates for this project would be those with a strong background in Business and Commerce, as well as experience in Turkish language-related work. +متاح ترجمة صوتية
I need a comprehensive Excel sheet tailored for tracking employee work hours, overtime, and materials. This sheet should allow for easy manual data input. Ideal skills and experience for the job: - Proficiency in Excel - Prior experience in creating tracking sheets - Good understanding of time and material tracking - Attention to detail
I'm looking for a professional with expertise in 3D design to create a model of a tent for camping that fits on a Tesla Model Y car. We allready have a design, but this design is copyrighted by somebody else. So we need to make some changes. (I have uploaded a photo of the part thats need to be redesignd!) Ideal skills for this project include: - Proficiency in 3D design software - Experience in designing outdoor equipment
I'm seeking an experienced architect or designer for a modern-style house elevation. Key Features: - The design needs to incorporate large windows as a defining feature of the modern aesthetic. - The exterior should predominantly use wood, blending contemporary design with natural materials. Ideal Skills: - Proficient in modern architectural design. - Previous experience with wood as a primary exterior material. - Strong portfolio of designs featuring large windows. I'm looking for a professional who can deliver a clean-lined, contemporary design that is both functional and visually appealing.
I need a seasoned developer to create a minimalist fintech app for both iOS and Android, tailored for contractors and builders. The app should feature: - A seamless credit application process - A user-friendly material catalog for browsing and ordering construction materials - An efficient payment tracking feature to monitor expenses The app must incorporate a basic user authentication system, allowing sign-ups and log-ins via email and password only. Additional elements of the project include: - Implementing both push and email notifications for users - Ensuring a simple and minimalistic design style throughout the app Ideal candidates for this project should have: - A strong background in fintech app development - Proficiency in cross-platform app development - Exper...
I'm seeking a professional to perform a high-resolution 3D scan on an automotive connector. The purpose of this scan is for reverse engineering. Ideal Candidates Should Have: - Extensive experience with 3D scanning - A strong background in reverse engineering - Ability to deliver high-resolution scans Skills Needed: - Proficient in 3D scanning technology - Attention to detail for high-resolution requirements - Experience with quality inspection and prototyping (beneficial)
...existing OxyGen product logos as a starting point and expand on it to build out the entire corporate identity. **Scope of Work** All branding assets should be versatile and optimized for use across multiple mediums, including print, digital platforms, videos, website elements, conference booth materials, promotional items, business cards, and other marketing collateral. The branding identity kit and style guide should include the following components, designed with a professional and technical aesthetic: Corporate Company Logo: • Design a company logo and icon vector graphs that complement the existing OxyGen product logos by utilizing the O2 icon which allows for future branding of additional products under the company’s umbrella. • Provide the l...
I'm in need of purchasing personal identity photos for the purpose of registering on various gaming websites. The individuals in the photos should be over 18, and can be of any age. I am specifically interested in identity from the following regions: Europe, the USA, Canada, and Australia. Ideal Skills and Experience: - A diverse portfolio of personal identity photos - Understanding of gaming website registration requirements - Ability to deliver images from specified regions - Proficiency in PNG format Please note: All images must be of males and over 18.
my website is if u are interested check the photos to see the current website speed and tell me what best result u can get and the time u will spend on the project before-and-after performance metrics (e.g., using tools like Google PageSpeed Insights or GTmetrix). Ongoing Suggestions: Offer recommendations for maintaining long-term performance. Qualifications: Proven expertise in Shopify optimization. Experience in optimizing for both desktop and mobile. Familiarity with tools like Google Lighthouse, PageSpeed Insights, or similar. Strong understanding of web performance best practices. Product pages should be prioritized for speed and performance enhancements. The project should be completed within 1-2 weeks.
