Detailed project report for construction of buildingJobs
Tengo un sistema web con reportes en crystal report y han dejado de funcionar los reportes. Al inspeccionar en el explorador tengo el sisguiente error: :15 Uncaught
Androidbuilder, mit app builder, kodular tools app building required
The specs for this project are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work ...
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...
500 word Microsoft Word, Rachmininoff, Symphony No. 2 Op. 27.
...this, then the job is not for you. I would like to encourage females to place a bid. Skills count for more than gender in the end, though. But women ROCK! ;) I will need something visual and/or clickable since I do not speak "tech" at all. It's like reading Mandarin or Swahili to me. Must work in the WP theme Astra. I can't provide link just yet to the Astra theme, since the developer is unavailable for a few days. We can buy the PRO version if needed. Go to The site is in danish, but the functions will be more or less the same. The job is ONLY for the price calculator with the green slider input, some variables as add-on choices with a preset default value, and the price with an output. We need a slightly simpler version of...
I don't read autogenerated responses to my ad. So if you want to be considered in relation to this job, please give me a proper offer. I need help with link building. Links must be created to follow pages Keyword: meeting booking, meeting bookers, new customers Keyword: telemarketing Keyword: Sales manager, hire a sales manager, What can you offer? NoFollow and Folllow - PageRang!
The creation of a virtual office
help me build this website --> http://burgaardsjuletræ
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg sk...lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel De...
I have my campaign
En novelle analyse og fortolkning af Dorthe Nors "Buddhisten" samt en perspektivering til den.
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
SEO SMO (FaceBook) Link Building Forum Posting Blog Posting
Link Building, SEO, Internet Marketing, Social Media Marketing, Market Research
fhgfhjfhjffhfjkfhfhhhhhhhhhhhhhhhhhhnmhvvnbvnmvnmvnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnkug
...through manually link building, leads generation, social media marketing... The website is a architect company which targets Denmark area. On-page optimization has already been done. Only off-page SEO optimization is required to improve keyword ranking on Google. For anyone interested in this project, please submit a detailed proposal of how the keywords will be ranked and the techniques used. Full report of the work done must be submitted. All work has to be done manually using white-hat processes. -- Only white hat, experienced, highly ranked on freelancer.com SEO experts should bid -- Quality back links must relate to site topic on high quality relevant sites -- No black hat, gray hat or unethical SEO methods are to b...
poster for online posts 3 pictures Bold
project for asferbert............................................................................................................................................................................................................................
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Internet marketing, SEO, Link Building, Facebook marketing
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting...
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting...
this is work what i done. xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xx x
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
