Data entry bidding sites ukJobs
fdfd fef sdfr sdfr grsdfvd rhwr gdg er gdv drt gtdvcg dhdfvcgf rd gdcg rgftgdrg fthftg dg dthg fthf hfyhft
Patterson Dental Eaglesoft database extraction - Patterson Dental Eaglesoft database extraction - Patterson Dental Eaglesoft database extraction - Patterson Dental Eaglesoft database extraction
html5 css khjjfd dlkfldkf d lkdlfkd fdfdlkf dfkdlfkdlkf k;jglfh bvlfhbl fl;bh lhvks vk vhsvhls vl slgs;g;s
89888765goldenbirds5646546465hgvtftfyddddrddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd
Programiranje za SQL i Android: molim vas vaš kontakt da se čujemo na telefon xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
a dialer for my asterisk box kasdjlasjdlasjdlasjdlasjdalsdjalsdjalskjdalskjdalskjdalksjdalskjdalskjdlksajdlasjdalsjdalsjdalsjdalsjalskjd 100chars
Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all
Data Entry for dangersystem_S_Coords_2_90373362_dangersystem_First_1500 Data Entry for dangersystem_S_Coords_2_90373362_dangersystem_First_1500
Data Entry for bd100m_S_Coords_3_57638273_bd100m…t1500 Data Entry for bd100m_S_Coords_3_57638273_bd100m…t1500
hi, i just need somebody for a few hours working for my project, if i like it i have more work. beste regards. Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugi...
...to work with you Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugiat a, tellus. Phasellus viverra nulla ut metus varius laoreet. Quisque rutrum. Aenean imperd...
SharePoint 2013 Responsive Design Html 5 For government internet site SharePoint 2013 Responsive Design Html 5 For government internet site
edit a songxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ddssvdddddfhfhdhjsakhdsakjhdsakhdjsköahdaskjhdsajhdsajkhdaksjhdsöhjdkajshdyaCDFUIVGHEFUBHVEUKRHBIOWUVYGWOIQUFWIVNGUQEHRPIUAFUHBIERUHHAEFEFVJHHJKFEHQFHRB BHIRRULGR
!!!!!!!!!!gjhggyug gujgjhguyfujgjhg yguyguyuuyg gjyguyg guyghgiug giuyghjbg ohugo giuygh ouighy oygo gougogo gougogyg gyugoig ogoy gyogog ogyb
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad ...
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
Data harvesting affdd gsfg hsdh sdgh hgh gjhh djdj h hdfjfd fj dfjhj jjf dgjddfdfd aas sf f aff adfd af df fdf fad f
i want install ngenx mod ..........................................................................................................................................
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
fsdfsdddddddderterterrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddddddddddddddddddddddddddd
Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NEED programmer ......................................................................00000000000000000000000000000000000000000000000000
jeanpierrejesses09 skype add me thanks xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
data entry dsaadsdasd sdaddf dsf f fds fds fdsf dsfds dsf fd fds dsf dfs fds dfs fsd sdf sdf f s fdsf fds f
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Transfer 20 sites from one Hosting company to another'
OUR COMPANY IS LOOKING FOR SKILLED INTERNET POSTING EXPERTS WHO CAN POST ON USA CLASSIFIEDS SITE INTERESTED PERSONS SHOULD CONTACT US AS SOON AS POSSIBLE THROUGH OUR SKYPE WHICH IS [Removed by Freelancer.com Admin]
...Responsibilities: - Administrative Tasks: This will encompass a broad range of duties including scheduling appointments, managing emails, and handling data entry. - Customer Support: You will be my online chat support, helping to deliver information to drivers, tracking the distance of orders, and providing assistance to restaurants. - Social Media Management: I need help managing my social media platforms. Ideal Skills and Experience: - Previous experience as a virtual assistant or in a similar role is highly preferred. - Excellent communication skills, both written and verbal. - Proficient in managing emails and scheduling. - Familiarity with data entry tasks. - Customer service experience, particularly in online chat support and restaurant assistance. - U...
I'm in need of a recruiter who can find and hire entry-level marketing and field sales personnel for my NGO in Hyderabad. The ideal candidates should possess excellent communication skills and have a background in customer relationship management. About Organization: Since 1995, SYJ Organization has been a beacon of hope, tirelessly working to uplift the lives of the underprivileged and create a more equitable society. What began as a small team of compassionate individuals has evolved into a dynamic and trusted organization dedicated to driving meaningful change. Key Requirements: - Recruiter should focus on entry-level candidates - Candidates should have strong communication skills - Experience in customer relationship management is a must - Prior experience or und...
I'm seeking an HR recruiter with a strong track record in sourcing executive assistants, particularly in Israel. The ideal candidate will have experien...recruiting executive assistants. - Proven track record working in Israel's job market. - Expertise in sourcing candidates with foreign citizenship. - Understanding of the skills essential for an executive assistant, particularly project management skills. - Ability to identify and recruit entry-level talent. Skills Needed: - Excellent communication and interpersonal skills. - Familiarity with project management principles. - Ability to assess bilingual proficiency, though not a requirement. The role is to find an entry-level executive assistant with strong project management skills. The candidate should ideally p...
I'm looking for a talented designer who can help tidy up our existing Corporate A4 brochure. The primary purpose of this brochure is to disseminate information to potential clients. Therefore, the ideal freelancer should have a good understanding of corporate communication and experience in designing client-facing material. Key Responsibilities: - Review and enhance the cu...experience in designing client-facing material. Key Responsibilities: - Review and enhance the current brochure - Ensure the brochure effectively communicates our company information to potential clients - Maintain a professional and appealing design Ideal Skills: - Corporate brochure design - Graphic design - Understanding of corporate communication Please share your portfolio of similar work when bidding...
My project involves extracting specific CAD data using a LISP routine in ZWCAD. The data to be extracted primarily consists of attribute data from 2D drawings, 3D models, and BIM data. Key Responsibilities: - Use LISP to extract attribute data from CAD files - Work with 2D drawings, 3D models, and BIM data Ideal Skills: - Proficiency in ZWCAD - Experience with LISP programming for CAD data extraction - Ability to work with various CAD data types Please provide examples of similar past projects when bidding.
I'm seeking assistance with copying SMS messages from a website into an Excel sheet. The messages need to be organized into multiple columns based on their date. Key Requirements: - Inputting message content, country into designated columns. - Categorizing messages by country. Ideal ...copying SMS messages from a website into an Excel sheet. The messages need to be organized into multiple columns based on their date. Key Requirements: - Inputting message content, country into designated columns. - Categorizing messages by country. Ideal Skills: - Proficiency in Excel. - Attention to detail for accurate data entry. - Basic understanding of categorization to assist in sorting by country. Sample of data is attached. Price is $ 15 for 5000 messages. Only 2 ...
I'm in need of assistance with a project involving typing from Google PDFs. The content of these PDFs is mixed, containing both text and images. - Document Length: Each PDF document is approximately 11 to 50 pages long. - Image Handling: The task requires extracting and processing images from the PDFs separately. Ideal candidates for this project should have experience with data entry, specifically PDF typing tasks. Skills in image processing and attention to detail are crucial, as each image needs to be handled separately.
I'm in need of an experienced web developer who can help me fix some HTML issues on my website. The primary concern is with the layout, specifically with the responsive design. The site is not displaying correctly on different devices, which is a major co...specifically with the responsive design. The site is not displaying correctly on different devices, which is a major concern. Ideal Skills: - Strong proficiency in HTML and CSS. - Experience with responsive web design. - Detail-oriented, able to spot and fix layout issues. In addition to the HTML work, I also need assistance with data entry tasks. This may include inputting text, images, or other data onto the site. Ideal Skills: - Fast and accurate data entry skills. - Familiarity with HTML an...
I need a data entry specialist who can extract text data from PDF documents for me. The type of data will mainly consist of paragraphs and sentences. Skills and experience ideal for this job: - Proficiency in data entry - Excellent attention to detail - Experience in handling and processing PDF documents - Ability to accurately extract and transcribe text
***DO NOT SUBMIT A GENERIC ENTRY I WILL BE DELETED*** I am looking for an experienced and creative designer to create a logo suitable for embroidery. I need the logo to be my dog with a smile with her tongue out a little. (See images) and I want hot pink cursive type text “Ella” The letter E should be something that looks like an open heart shape sideways. Will also need AI, PSD Indesign etc files. 300 DPI etc I want it of her head straight on. This will be added to a polo shirt with a small logo, a hat and other shirts so please think about how it will look embroidered with threads. Key Requirements: - Professional: The logo should represent my company image and values. - Suitable for Embroidery: The final design should be suitable for embroidery on various mat...
I need high-quality, detailed 3D models of furniture items for marketing and advertising purposes. Some of these models are ready, some need to be done. You are bidding for one model, where model is ready and just needs to be rendered in a setup. Requirements: - Creation of high-detail 3D models with textures - Understanding of models needed for marketing purposes - Experience with realistic modelling for furniture items Skills: - Proficiency in 3D modelling software - Experience in creating detailed textures - Ability to deliver high-quality visuals for marketing Please note that the specific types of furniture may be discussed further, as I have not yet selected a particular subset. Your portfolio showcasing similar past projects would be greatly appreciated.
I'm seeking a skilled freelancer to oversee regular updates and implement strategies to boost...maintenance - Experience with Email Marketing and SEO Optimization - Good understanding of community interaction and niche content engagement - Excellent communication skills for weekly video discussions Content Types: - Text content, Images and graphics, Links and resources Ideal Candidate: You should have a knack for creating engaging content updates and a proven track record of driving traffic to sites. Understanding of community engagement and interaction is key. Your SEO and Email Marketing skills will be crucial in our efforts to increase our site's visibility and reach. Must post a bid and put - This is NOT AN AUTOMATED BID,. Also bid your amount. Dont bid and then ask...
I'm in need of a diligent data entry specialist to assist with manual entry of employee records. The records are currently in PDF files, and will need to be transcribed into Employment Hero. We have approx 30 employees including contractors. We would also want procedures and policies imported into Employment hero, currently approx 400 procedures. Ideal Skills and Experience: - Proficiency in data entry - Experience with PDF to data transcription - Familiarity with Employment Hero is a plus - Attention to detail - Excellent typing skills - Ability to maintain confidentiality and handle sensitive information with discretion.
I'm in need of a freelancer with strong data entry skills and creative writing abilities. The project revolves primarily around data entry, followed by crafting engaging product descriptions. Key Responsibilities: - Data Entry: Accurately inputting data into specified systems. - Content Creation: Writing captivating product descriptions. Ideal Skills: - Proficient in data entry. - Excellent command of the English language. - Creative and engaging writing style. - Experience in product description writing is a plus. I also need help with blog post topics, so a freelancer who is good at suggesting relevant and engaging content ideas would be a great fit.
