Current journal of science and technologyJobs
Looking for freelancer programmer, this is a long term project. Prefer to developers who have experience of this type of website. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Adifier Child Theme (Classified Ads WordPress Theme) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Currently have a website issue that needs to be fixed on Hosting is with Hostinger and I reached out to them for help and this is the reply: To help reestablish the connection between your Adifier theme and the WordPress database for the recent ads, you can try the following steps: Clear Cache: If you are using a caching plugin or your hosting provides caching services, clear the cache. Sometimes, outdated...
...are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work with the type of solution we us...
I need an skilled Wordpress / Woocommerce freelancer, to help me fix a few minor issues on my website. The website is running on wordpress and woocommerce. My theme installed is Deasil Travel theme My website is I need the following things sorted: 1 - I have several pages like this ex. where there is no header image shown. I need this to be fixed, so that every page like that, is showing the same top header image similar to this 2 - All my tours is created as products in wordpress Ex. Under the tab "Dagsprogram" I want for each day shown, be able to add a shortcode for the Image Carousel plugin from shortcode ultimate
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash"...keys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You can test her...
Programmable timer unit with web UI for commercial application, such as school, factory etc. Hardware is ready. Only requires Firmware programmer in C ++ and with embedded web technology for user interface, to set or program the unit
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
Hi at the moment i'm looking for someone who can edit my current website. I'm making a Counter-Strike Global Offensive betting site, look at to see an example of what I need to get made. I already have a bot coded for steam which at the moment accept CSGO Key's (a item) and then insert each user into a db which the website then will pick a random winner from. I need this bot and website edited so that you can bet all kinds of items and it will calculate the median of each item's value and then add the amount into %. Lets say the pool close at 100 items, 1 guy bet 10$, another one bet 40$ and last guy bet 90$. Then the guy with the 90$ will have the highest % chance of winning.
...systems design, computer science and computer networks. PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each train compartment or bus is already equipped with a wireless LAN connected to the InterNet. The train or...
...systems design, computer science and computer networks. PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each train compartment or bus is already equipped with a wireless LAN connected to the InterNet. The train or...
poster for online posts 3 pictures Bold
blog posting like SEO,DESIGNING,SOCIAL MEDIA,TECHNOLOGY
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I need an expert software developer to integrate my CRM software, AccuLynx, with my existing systems. The primary focus of this integration will be on lead management. Key Requirements: - Integrate AccuLynx with my current systems to streamline lead management processes. - Ensure seamless data flow and interaction between systems. Ideal Skills: - Proficiency in software integration, specifically with AccuLynx. - Strong understanding and experience in lead management systems. - Excellent problem-solving skills to troubleshoot any potential issues during integration.
...The current mIoU is ~40%; the goal is at least 80% mIoU using a novel and lightweight architecture (≤ 1M parameters). Requirements: - Experience in hyperparameter tuning, data augmentation, and fine-tuning. - Access to a GPU or high-performance computing resources. Responsibilities: - Design a novel, lightweight model architecture for semantic segmentation. - Optimize training processes and implement advanced techniques for performance improvement. - Train the model using high-performance resources. - Provide detailed documentation and actionable insights for further refinement. Deliverables: - A trained model achieving the target mIoU with a novel architecture. - Updated, well-documented code with clear comments. - A comp...
My website needs to meet certain legal standards in Germany, specifically: - Cookie Consent Compliance - GDPR Compliance - Creation of an Impressum Page I require assistance with both the content and the tools necessary to achieve this. Furthermore, I need these legal elements to use a standard, compliant design, rather than matching my current site design or needing design suggestions. Ideal candidates should have: - Extensive experience in HTML web development - A deep understanding of German legal web requirements - Ability to design standard, compliant elements - Strong content creation skills
...e-commerce manager to leverage AI technology and develop my existing business concept into new European markets. You will be trained in our unique web management system, which offers a distinctive approach to overseeing our online presence. Key Responsibilities: - Primarily focusing on AI integration and automation to streamline our operations and enhance efficiency. - Localizing and translating our content to cater to German, French, and all other markets in Europe. - Automating our marketing campaigns to reach and engage potential customers in these new territories. Ideal Skills and Experience: - Proven track record in e-commerce, particularly in expanding businesses into new markets. - Extensive experience with SEO. - Proficie...
I have HTML, CSS & Javascript files fo...Javascript files for my website. There are 5 HTML files, 1 CSS file and 1 Javascript file. Need someone to optimize the code for mobile devices as it only works for laptops and PCs right now. The entire website needs attention for mobile optimization, including: - Navigation menus - Images and media - Text and content layout I want the website to be optimized for all common mobile sizes. There are existing issues that need to be addressed: - Elements overlapping or misaligning - Content being too small or too large - Interactive elements being hard to use Ideal skills for the job include: - Proficiency in HTML, CSS and Javascript - Experience in mobile website optimization - Attention to detai...
...with React and Supabase. The application includes a financial management module where users need to import payment/transaction data via CSV files. Current Setup: - Frontend: React with TypeScript - Backend: Supabase - Relevant Tables: * raw_payment_imports (for storing initial CSV data) * accounting_transactions (for processed transactions) - Current Implementation: PaymentImport component with CSV upload functionality Current Issues: 1. The import process is not working correctly when uploading CSV files 2. Raw data needs to be stored in raw_payment_imports table before processing 3. Data validation and error handling need improvement 4. Imported data should be immediately displayed in a table after upload Required Features: 1. CSV File Upload:...
We are seeking a skilled and motivated developer to integrate **Daily Bots** into our **React** and Node.js-based website, which is backed by a **PostgreSQL** database. This integration will enable automated text updates on our platform, leveraging cutting-edge voice and video agent technology. About Daily Bots Daily Bots empowers developers to rapidly deploy **voice and video agents** within their applications. Built with **Open Source SDKs** and running on **Daily’s real-time global infrastructure**, Daily Bots enables: - **Natural AI Conversations**: Create AI agents that interact seamlessly in natural language. - **Flexible AI Design**: Integrate voice-to-voice AI with leading models from **Anthropic**, **Cartesia**, **Deepgram**, **El...
I'm in need of a seasoned Shopify developer who is fluent in Arabic (preferred) or English to help with my Shopify store. The project entails: 1. Replacing my current supplier with a new one on DSers and syncing it correctly with my Shopify store. 2. Setting up multiple backup suppliers for my products to ensure smooth operations in case of price changes or shipping issues. 3. Reviewing my store settings to optimize product and supplier management. 4. Providing guidance on best practices for efficient supplier management. Skills and experience in Shopify, DSers, and e-commerce is crucial for this task. Communication can be in either Arabic or English as both are acceptable. Looking forward to your application!
...branding and meet local government requirements. The menu needs to be eye-catching, functional, and available in both English and Spanish. **Requirements:** 1. **Design Style:** - Reflect a local, beachy, bar aesthetic. - Incorporate our updated high-resolution logo (attached). - Ensure the design is easy to read and follows a Z-pattern layout for optimal readability. 2. **Menu Format:** - Front-and-back design (similar to the current menu attached). - Include all current menu items and their ingredients. - Add space for future edits and new items. 3. **Additions to the Menu:** - Add "10 pesos for an extra side of sauce" and "40 pesos for protein powd...
...website with a new layout. The primary goal of this project is to enhance the site's design and improve its overall user experience. My website is now visible at and I would like to have something more similar to Key Focus Areas: - Layout Redesign: The main objective is to completely redesign the current layout of the will create a design along with sub pages first for review and approval before we proceed to coding. - Performance Optimization: I am particularly concerned with improving the page load speed and mobile optimization. The redesigned site should load quickly and be fully responsive on all devices. Ideal Skills: - Proficiency in WordPress: Extensive experience in WordPress development and design is a ...
...with hardware interaction and Backend experience to create a new application for a screenless watch designed for the elderly. The watch currently operates using the Miwitracker app and communicates via a 4G SIM card. Key Project Features: - The new application should replicate all existing features of the Miwitracker app, including health monitoring and location tracking, but with a fresh, user-friendly UI design. - Implement a feature for custom notifications. - Connect the watch to new servers, creating a separate Backend from the current Miwitracker app. Health Monitoring: - The app should track heart rate, steps, and sleep patterns. Ideal Skills: - Extensive experience in iOS and Android app development. - Proven track record in cr...
I need an AutoCAD specialist to help me add an interior wall to my house layout. I have the design file and rough measurements for the new wall. The task is urgent and needs to be completed within 30 minutes. Ideal skills for this job include: - Proficiency in AutoCAD - Experience with residential layouts - Ability to work quickly under time pressure - Good understanding of spatial design I look forward to swift and competent assistance.
...create an application that extracts and organizes links from *IFRAME HTML content*. The application should: 1. Gather all information from IFRAMES using *JavaScript* or *Python*. 2. Extract all links from the HTML content within the IFRAMES and compile them into a list. 3. From this list, generate a *unique list of links* (remove duplicates). 4. Associate each link with an image so that clicking the image will redirect to the corresponding URL. 5. Host the application on my domain, ensuring it's easily accessible online. I believe this project may require a *web crawler* or similar scraping technology to efficiently collect and process the data. *Deliverables:* • Fully functional application/script. • ...
I am in need of a whiteboard animation video that can visually break down and explain a scientific theory. Key Points: - The primary goal of the video is to simplify a complex concept. The freelancer is expected to be able to not only animate, but to depict the concept in a clear, engaging and highly understandable manner. Ideal Skills: - Experience in creating whiteboard animations is crucial. Prior work examples or a compelling portfolio in this area would be a strong asset. - A background in science, or the ability to comprehend and explain scientific theories in a simple and effective way, is highly desired. - A creative and engaging animation style that can hold the viewer's attention throughout the video is important. ...
I'm seeking an expert web developer to replicate an MLM website. The project involves mirroring both the design and functionality of the reference site without any extra features. Key user interactions must include: - User registration and login - Payment processing - Referral tracking Please ensure the copied site is fully functional and mirrors the original in its entirety.
