Components of system in simulationJobs
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash":"17978758530268586595","boxName":"chan51-8888","baseHost":"","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersio...
I m working in voip in Morocco from 2014 I have a system of asterisk Isabel the problem is when my client send me trafic give him an erreur 486 must be 503 In this case my client lost his traffic https://www.freelancer.com/users/l.php?url=https:%2F%%2Fusers%%3Furl%3Dhttp:%252F%%252Fpt%252FA42hBUju%26sig%3D50c67e1b3a7f27f20771fd2ee320f07b9eb302904f9e19edea3a28d328aafbdf&sig=dbffe148af4b5367f232a97a6acda81aea4364dfabcb09ccf07b413f3f1c3be9
...mit team og jeg en komplet hjemmeside med et system programmeret i PHP & MYSQL, som skal fungere som et mellemled. Det som vi i virkeligheden ønsker os, er at sætte gang i hjulene på onlinedelen, og dermed få et godt tilbud til en fornuftig pris. Vores virksomhed sikre den private handel bliver gennemført præcis efter den indgåede aftale, ved at sælger og køber udføre handlen igennem vores platform, og dermed udelukker muligheden for svindel. Vi ønsker at hjemmesiden skal se moderne ud og helst noget der passer til vores branche. Der skal være gode muligheder for videreudvikling på senere tidspunkt. Vi ønsker at bruge farven blå, hvid og sort. Det skal se godt ud og kunden skal ...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
Opgradering af booking system fra installation program til online booking system mysql Kan laves med komplet engelsk sprog men ved mulighed for at vi kan lave ekstra sprog som man kan vælge som kunde. Har beskrevet lidt om det i vedhæftet pdf.
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Adempiere Finance Functional Consultant for desigining Ecommerce & Accounting System
Design A Catalog Of Products (1 Page)
Krav specifikation er på plads - Den opdateret version kommer senere.
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' pizza online ordrering system with sms gataway '
poster for online posts 3 pictures Bold
Hej, Mit navn er Frederik og jeg har fået en idé der omhandler odds/spille på kampe. Her er lidt information omkring projektet: At spille på fodboldkampe, tennis kampe, NBA og andre sportsgrene er populær i alle aldre nu til dags,...spillere som størstedelen af deres forslag, er vundet. Kunder på siden, der søger forslag, skal betale for at se premium spillernes forslag. Det skal siges det er gratis at oprette sig på siden og at oprette forslag. Har du spørgsmål, svarer jeg gerne, så fyr løs! Men det jeg søger, er et tilbud, højst sandsynlig af en programmør. Vi leder nemlig efter en der kan lave et system der passer til projektet. Altså et system der kan ...
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
Two bottles designed with embossed logos and a website link. Embossed logo on the front, link on the bottom of the bottles. Readjustment of the thread to meet the SP standard on the bottle To deliver: Two native files (Autodesk Inventor 2025). Two neutral files STP.
I'm in need of a 3D model for a Cetme-c flat receiver along with a 3D bending jig. The bending jig should have a medium level of detail, incorporating some features but not all. Key Requirements: - A 3D model of a Cetme-c flat receiver. - A 3D bending jig with a medium level of detail. I have rough measurements for the receiver, so assistance with final specifications will be needed. The bending jig does not require compatibility with specific tools or machines, so designs for standard tools will suffice. Ideal Skills: - 3D modeling and design experience. - Knowledge of firearms and related components. - Ability to work with rough specifications and refine them into precise models.
I'm in need of a highly detailed 3D model of the STG 44 flat receiver, complete with a 3D printable jig for assembly. The jig is needed specifically to assist in the assembly of the receiver. Key Requirements: - The 3D model must be highly detailed, incorporating internal components as well as the basic structure and mounting points. - The 3D printable jig should be designed for use in the assembly of the receiver. - I'm looking for the final design files to be delivered in the STEP format. Ideal skills and experience for this job: - Expertise in 3D modeling software, with a portfolio of similar projects. - Experience with designing for 3D printing. - Understanding of mechanical assembly and w...
...up the link in bio, Highlights, Update Links, review and check the Funnels, and make sure all the fonts and styles match and who knows social media marketing and help me review the site and give me tips to improve it. The tasks include: Instagram • Set up the bio and links • Link to systeme • Create a highlights reel and cover stickers for each section Systeme • Fix the bottom and header in systeme and making sure all the links work and link to the courses, tools, homepage, about me, and contact page • Populate the post list page • Update the links in the blogs to the new current affiliate links including N26 • Add automations in place where required • There are a few buttons that need to be changed • Updating th...
I'm looking for a skilled developer to create a minimal Microsoft Teams bot. This bot will handle incoming PSTN or Teams calls by directing t...them to the first user. If the call isn't answered, it must redirect to a second user using the MS Graph API method Redirect. Requirements: - The bot must be developed preferably in Kotlin, though other languages like Golang, C# and others are also acceptable. This is a POC, proof of concept to explore the Graph API capabilities. - The bot must obligatory use the API method Redirect to redirect the call to the second user. - The bot will be deployed on Azure. - The bot must log call details. Ideal Skills: - Proficient in bot development for Microsoft Teams. - Familiar with MS Graph API and Azure. - Experience in...
I need an expert in Arena simulation software to analyze the performance of a specific manufacturing process. The primary aim is to assess various aspects such as production efficiency, error rates and machine usage. Key requirements: - Proficient in using Arena simulation software - Previous experience in analyzing manufacturing processes - Ability to identify key performance indicators and provide detailed insights - Excellent problem-solving skills, capable of suggesting potential improvements based on the analysis. The ultimate goal is to understand the overall system performance of the manufacturing process and identify areas for optimization.
I...developer to convert my existing Ionic application into an iOS version, alongside a complete UI redesign. - The iOS version should retain all functionalities as the current Ionic application. - The UI redesign is a critical part of this project. While I haven't specified a particular style, I'm open to suggestions and would appreciate a modern, user-friendly design. - The app should remain functionally identical to the existing version, so a thorough understanding of both iOS development and the Ionic framework is crucial. Ideal Skills and Experience: - Extensive experience in iOS app development - Proficiency with the Ionic framework - Strong UI/UX design skills - Ability to deliver a high-quality, bug-free application on time - Excellent communication...
...days out on schedules that are made in advance. We have three separate color groups of employees on 3 different shifts. The color groups are Red, yellow, and Blue and the shifts are 1st, 2nd, and 3rd. Each color group has eight employees on it. This means we have a total of 24 employees on each shift and grand total of 72 employees in the department. In most situations we have two color groups working each shift, except on Wednesdays when all three-color groups are working. That means on Wednesdays we have a bunch of extra people that we either double up on jobs or assign them special tasks those days. The reason for all color groups being there is mainly to schedule trainings, or department meetings when all employees are scheduled to b...
I'm in need of a professional with extensive experience in managing Jetson AGX Orin systems. The project involves: - Remote service for flashing the Jetson AGX Orin. - Configuring the 40 pin header for digital inputs/outputs and PWM signals. The 40 pin header will be connected to encoders and cameras. Therefore, a solid understanding of interfacing such peripherals is essential. Your expertise in this domain will ensure the success of this project.
...----------------------------------------------------------------------- I need to re-run a published paper work, and precisely, the BKL model using different alpha/gamma parameters as shown in Table#3 in the experiment section (see attached table and paper). The project involves: - Understanding published paper code in github: . Basically, - It's a hybrid of two models: Splade (MLM Bert based retrieval model) and Colbert (HuggingFace ranking model) - already done. - Running the code on a slurm/linux cluster Ideal candidates should have: - Experience in understanding complex LLM code - must - Prior work with the Splade and Colbert models - or any LLM model - Familiarity with slurm clusters - optional I will provide access to ...
I'm in need of a large, eye-catching decal for the back of my caravan. The design should be in a vintage style and use a bold and bright color scheme. Key components of the design include: - The words "CanAussie Cruisers" in an arc at the top - The Canadian and Australian flags crisscrossed in the middle - The phrase "Georgia 2" with an accompanying image of our cruising boat at the bottom (I will provide a picture) - The details of our CB radio channel at the very bottom Ideal candidates for this project should have: - A strong portfolio in vintage design - Experience in creating large-scale decals - Ability to work with provided images and text - Excellent understanding of...
...vectorial PDF design of my logo and accompanying text. The final product needs to be print-ready. Key requirements: - Color gradient: An important aspect of this project is accurately applying the specified orange color gradient. - Handwritten Style: The logo's handwritten aesthetic needs to be meticulously replicated. - File Organization: Both the logo and text should be in separate files, alongside a combined file that mirrors the example picture. The example picture is in PNG format. Additional requirements: - Font: You will need to use the font from the example picture for the text. - File Format: The final deliverables should be in AI (Adobe Illustrator) format. Ideal candidates for this project should have significant experience in...
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
