Characteristics of queuing system in simulationJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 characteristics of queuing system in simulation jobs fundet

    I have a Matlab Simulation Task...

    €11 Average bid
    €11 Gns Bud
    3 bud

    In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash":"17978758530268586595","boxName":"chan51-8888","baseHost":"","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersio...

    €41 Average bid
    €41 Gns Bud
    12 bud

    I m working in voip in Morocco from 2014 I have a system of asterisk Isabel the problem is when my client send me trafic give him an erreur 486 must be 503 In this case my client lost his traffic https://www.freelancer.com/users/l.php?url=https:%2F%%2Fusers%%3Furl%3Dhttp:%252F%%252Fpt%252FA42hBUju%26sig%3D50c67e1b3a7f27f20771fd2ee320f07b9eb302904f9e19edea3a28d328aafbdf&sig=dbffe148af4b5367f232a97a6acda81aea4364dfabcb09ccf07b413f3f1c3be9

    €402 Average bid
    €402 Gns Bud
    6 bud

    ...mit team og jeg en komplet hjemmeside med et system programmeret i PHP & MYSQL, som skal fungere som et mellemled. Det som vi i virkeligheden ønsker os, er at sætte gang i hjulene på onlinedelen, og dermed få et godt tilbud til en fornuftig pris. Vores virksomhed sikre den private handel bliver gennemført præcis efter den indgåede aftale, ved at sælger og køber udføre handlen igennem vores platform, og dermed udelukker muligheden for svindel. Vi ønsker at hjemmesiden skal se moderne ud og helst noget der passer til vores branche. Der skal være gode muligheder for videreudvikling på senere tidspunkt. Vi ønsker at bruge farven blå, hvid og sort. Det skal se godt ud og kunden skal ...

    €1103 Average bid
    €1103 Gns Bud
    3 bud

    We must have set up a new asterisk server that follows the normal asterisk guidelines. We also need a script where we provide the telephone number (DID), opening hours also agents who are queuing, then it must do the setup in configs.

    €151 Average bid
    €151 Gns Bud
    3 bud

    I have wire frame

    €153 Average bid
    €153 Gns Bud
    4 bud

    The creation of a virtual office

    €158 Average bid
    €158 Gns Bud
    4 bud

    ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish

    €195 Average bid
    €195 Gns Bud
    4 bud

    Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid

    €148 Average bid
    €148 Gns Bud
    5 bud
    €12 / hr Gns Bud
    4 bud
    Build of models
    Udløbet left

    Autocad designing

    €272 Average bid
    €272 Gns Bud
    6 bud
    Booking system
    Udløbet left

    Opgradering af booking system fra installation program til online booking system mysql Kan laves med komplet engelsk sprog men ved mulighed for at vi kan lave ekstra sprog som man kan vælge som kunde. Har beskrevet lidt om det i vedhæftet pdf.

    €4351 Average bid
    €4351 Gns Bud
    17 bud

    COPY OF AN ECOMMERCE SITE NEED My budget 30 usd

    €28 Average bid
    €28 Gns Bud
    2 bud

    Adempiere Finance Functional Consultant for desigining Ecommerce & Accounting System

    €89 Average bid
    €89 Gns Bud
    4 bud

    Design A Catalog Of Products (1 Page)

    €17 Average bid
    €17 Gns Bud
    12 bud
    €29 - €29
    0 bud

    Krav specifikation er på plads - Den opdateret version kommer senere.

    €580 Average bid
    €580 Gns Bud
    1 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' pizza online ordrering system with sms gataway '

    €10 - €10 / hr
    €10 - €10 / hr
    0 bud

    /findtranscript/ error.. pls fix

    PHP
    €18 Average bid
    €18 Gns Bud
    17 bud
    Bank teller system
    Udløbet left

    Bank teller system

    €8 / hr Average bid
    €8 / hr Gns Bud
    1 bud

    poster for online posts 3 pictures Bold

    €21 Average bid
    €21 Gns Bud
    13 bud

    Hej, Mit navn er Frederik og jeg har fået en idé der omhandler odds/spille på kampe. Her er lidt information omkring projektet: At spille på fodboldkampe, tennis kampe, NBA og andre sportsgrene er populær i alle aldre nu til dags,...spillere som størstedelen af deres forslag, er vundet. Kunder på siden, der søger forslag, skal betale for at se premium spillernes forslag. Det skal siges det er gratis at oprette sig på siden og at oprette forslag. Har du spørgsmål, svarer jeg gerne, så fyr løs! Men det jeg søger, er et tilbud, højst sandsynlig af en programmør. Vi leder nemlig efter en der kan lave et system der passer til projektet. Altså et system der kan ...

    €329 Average bid
    €329 Gns Bud
    3 bud

    Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

    €147 - €441
    €147 - €441
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €147
    €18 - €147
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud

    Tunne a linux server

    €145 - €145
    €145 - €145
    0 bud

    im looking for an estimate on creating a cad drawing of the ring that i uploaded

    €29 - €242
    €29 - €242
    0 bud

    As per skype conference

    €435 Average bid
    €435 Gns Bud
    1 bud

    Hi, i need social shares

    PHP
    €29 - €29
    €29 - €29
    0 bud

    Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...

    €387 Average bid
    €387 Gns Bud
    5 bud

    I'm in need of a sophisticated, luxurious design for my cosmetics product's packaging and labeling. The design should be minimalistic yet exuding a sense of luxury. Key Requirements: - Design for a Skincare product - Luxurious and minimalist design style - Glossy finish for the packaging Ideal Candidates: - Experienced in packaging design, particularly for Skincare - Portfolio showcasing luxurious and minimalist design - Familiarity with glossy finishes and how to design for them Label Design Instructions Front Label Product Name & Highlight: Place "C to It Anti-Age Moisturizer" prominently at the top-center in an elegant, modern font. Highlight "Vitamin C-Infused" below the name as a key selling point. Key Features:...

    €184 Average bid
    Garanteret
    €184
    12 indlæg

    Two bottles designed with embossed logos and a website link. Embossed logo on the front, link on the bottom of the bottles. Readjustment of the thread to meet the SP standard on the bottle To deliver: Two native files (Autodesk Inventor 2025). Two neutral files STP.

    €48 Average bid
    €48 Gns Bud
    1 bud

    I'm looking for a skilled developer to create a minimal Microsoft Teams bot. This bot will handle incoming PSTN or Teams calls by directing t...them to the first user. If the call isn't answered, it must redirect to a second user using the MS Graph API method Redirect. Requirements: - The bot must be developed preferably in Kotlin, though other languages like Golang, C# and others are also acceptable. This is a POC, proof of concept to explore the Graph API capabilities. - The bot must obligatory use the API method Redirect to redirect the call to the second user. - The bot will be deployed on Azure. - The bot must log call details. Ideal Skills: - Proficient in bot development for Microsoft Teams. - Familiar with MS Graph API and Azure. - Experience in...

    €143 Average bid
    €143 Gns Bud
    7 bud

    I need an expert in Arena simulation software to analyze the performance of a specific manufacturing process. The primary aim is to assess various aspects such as production efficiency, error rates and machine usage. Key requirements: - Proficient in using Arena simulation software - Previous experience in analyzing manufacturing processes - Ability to identify key performance indicators and provide detailed insights - Excellent problem-solving skills, capable of suggesting potential improvements based on the analysis. The ultimate goal is to understand the overall system performance of the manufacturing process and identify areas for optimization.

    €29 - €242
    €29 - €242
    0 bud

    I...developer to convert my existing Ionic application into an iOS version, alongside a complete UI redesign. - The iOS version should retain all functionalities as the current Ionic application. - The UI redesign is a critical part of this project. While I haven't specified a particular style, I'm open to suggestions and would appreciate a modern, user-friendly design. - The app should remain functionally identical to the existing version, so a thorough understanding of both iOS development and the Ionic framework is crucial. Ideal Skills and Experience: - Extensive experience in iOS app development - Proficiency with the Ionic framework - Strong UI/UX design skills - Ability to deliver a high-quality, bug-free application on time - Excellent communication...

    €496 Average bid
    €496 Gns Bud
    13 bud

    ...days out on schedules that are made in advance. We have three separate color groups of employees on 3 different shifts. The color groups are Red, yellow, and Blue and the shifts are 1st, 2nd, and 3rd. Each color group has eight employees on it. This means we have a total of 24 employees on each shift and grand total of 72 employees in the department. In most situations we have two color groups working each shift, except on Wednesdays when all three-color groups are working. That means on Wednesdays we have a bunch of extra people that we either double up on jobs or assign them special tasks those days. The reason for all color groups being there is mainly to schedule trainings, or department meetings when all employees are scheduled to b...

    €557 Average bid
    €557 Gns Bud
    90 bud

    I'm in need of a professional with extensive experience in managing Jetson AGX Orin systems. The project involves: - Remote service for flashing the Jetson AGX Orin. - Configuring the 40 pin header for digital inputs/outputs and PWM signals. The 40 pin header will be connected to encoders and cameras. Therefore, a solid understanding of interfacing such peripherals is essential. Your expertise in this domain will ensure the success of this project.

    €234 Average bid
    €234 Gns Bud
    3 bud

    ...----------------------------------------------------------------------- I need to re-run a published paper work, and precisely, the BKL model using different alpha/gamma parameters as shown in Table#3 in the experiment section (see attached table and paper). The project involves: - Understanding published paper code in github: . Basically, - It's a hybrid of two models: Splade (MLM Bert based retrieval model) and Colbert (HuggingFace ranking model) - already done. - Running the code on a slurm/linux cluster Ideal candidates should have: - Experience in understanding complex LLM code - must - Prior work with the Splade and Colbert models - or any LLM model - Familiarity with slurm clusters - optional I will provide access to ...

    €1183 Average bid
    €1183 Gns Bud
    30 bud

    ...vectorial PDF design of my logo and accompanying text. The final product needs to be print-ready. Key requirements: - Color gradient: An important aspect of this project is accurately applying the specified orange color gradient. - Handwritten Style: The logo's handwritten aesthetic needs to be meticulously replicated. - File Organization: Both the logo and text should be in separate files, alongside a combined file that mirrors the example picture. The example picture is in PNG format. Additional requirements: - Font: You will need to use the font from the example picture for the text. - File Format: The final deliverables should be in AI (Adobe Illustrator) format. Ideal candidates for this project should have significant experience in...

    €71 Average bid
    €71 Gns Bud
    99 bud

    I'm seeking a skilled professional with experience in ABAQUS Simulia to simulate shoulder movement using two types of prosthetics - reverse and custom made. Key Aspects: - The primary focus of the simulation will be the range of motion of the shoulder with each type of prosthetic. - I have existing 3D models for the prosthetics, so no assistance will be needed in that regard. Deliverables: - The simulation report should include visual animations and numerical data. - Graphs and charts are not necessary. - video of the process Ideal candidates for this project should have: - Proficiency in ABAQUS Simulia or Ansys. - Experience with biomechanical simulations. - Ability to present data in a clear and...

    €234 Average bid
    €234 Gns Bud
    4 bud

    I have a Laravel-based MLM system that needs urgent attention. Implement Rebirth Fallback Rule for root users with no direct recruits. Track and Place Rebirths Dynamically under the latest instance of rebirth. Fix Position Tracking Logic in the downline hierarchy to reflect filled positions accurately. Update Income Distribution Logic to align with direct income, team income, and rebirth income rules. For the commission calculation, it should take into account the Issue 1: Root User Rebirth When There’s No Direct Recruit Problem: The root user completes their 12-member downline, qualifying for rebirth. However, rebirth requires placement under a direct recruit, and the root user has no direct recruits. Issue 2: Rebirth Under Direct Recruit When Rebirth Exists ...

    €45 Average bid
    €45 Gns Bud
    12 bud

    I need a small, professionally styled motion graphics animated video of my company logo. This animation will primarily be used for presentations, so it needs to be polished and visually appealing to match the tone of a corporate setting. Ideal skills and experience for this job include: - Proficiency in motion graphics software - Experience in creating professional, corporate-style animations - Ability to deliver high-quality work suitable for presentations The final animation should seamlessly integrate with a variety of presentation formats and maintain a high level of visual quality.

    €17 Average bid
    €17 Gns Bud
    13 bud

    I'm in need of a skilled PCB designer who can create a comprehensive PCB design from my provided circuit in a PDF format. The primary goal for this project is product development, so the design should be suitable for that purpose. Key Tasks: - Interpret and translate the provided circuit information into a functional PCB design. - Ensure the design is compatible with Proteus 8 Demonstration for simulation purposes. Ideal Skills: - Proficient in PCB design software, with experience in Proteus 8. - Understands the intricacies of design for product development. - Capable of creating both SMD and Through-hole designs as needed. Note: The specific types of components or size constraints for the PCB design have not been dete...

    €10 - €68
    Forseglet NDA
    €10 - €68
    18 bud