Characteristics of bill of exchangeJobs
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
...detailed proposal of how the keywords will be ranked and the techniques used. Full report of the work done must be submitted. All work has to be done manually using white-hat processes. -- Only white hat, experienced, highly ranked on freelancer.com SEO experts should bid -- Quality back links must relate to site topic on high quality relevant sites -- No black hat, gray hat or unethical SEO methods are to be used -- no junk profile building techniques are to be used -- No use of automated software or bots -- No links from under construction pages -- No java links, jump scripts, framed pages, redirects, cloaking, CSS redirects, 301 redirects, dynamic links, flash sites/pages, hidden links, no string parameters, etc. -- No link farms, traffic exchange...
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
My Exchange 2016 server is currently offline due to a certificate issue. It's an expired certificate and I'm in the diagnosis stage. I have full access to the server and its details. Transport problem. I need an expert to help me figure this out as soon as possible. Ideal Skills and Experience: - Extensive knowledge of Exchange 2016 - Certificate diagnosis and troubleshooting skills - Experience with certificate renewal and installation - Ability to work under pressure and meet tight deadlines - Excellent communication skills for clear updates and explanations
I'm seeking to create a comprehensive database of US companies in the medical device cleaning and medical facilities cleaning industries. The database should include email contact for the CEO and number of employees of the company. I will buy lists of 1000 contacts each time I may buy lists from more than one bidder, and may buy more than one list per bidder to the extent the lists provided have the right level of quality. You should quote the price for each list of 1000 contacts. Ideal Skills: - Data mining - Database creation - Market research - Lead generation Experience: - Prior experience in compiling corporate databases - Familiarity with the medical device or cleaning industry is a plus.
Do the proof of concept as required in the pdf document.
I'm looking for a professional who can summarize a 20-page dental article for me. Despite the article being 20 pages, only 7 are actual content and the rest are references. The summary should be concise, limited to half a page, and cover the title, purpose, method, results, and conclusion of the article. The article primarily focuses on clinical practices within the dental field. Experience in the dental field or with clinical practices articles would be a bonus, but not necessary.
Analysis of the effects of WTO accession on trade
...looking for a digital illustration that depicts a beer bottle in the style of a Corona bottle. The cap should be separated from the bottle. Key Requirements: - The label on the bottle should only contain the text "brewery co." and just below that, "classic beer". - There should be a kind of light golden aura around the bottle. This illustration is intended for a jean, so the background should be as minimal as possible, ideally just the illustration itself. Ideal Skills and Experience: - Proven experience in creating digital illustrations, particularly of product designs. - Ability to create detailed and accurate representations of real-world objects. - Prior work with apparel designs is a plus. - Strong understanding of color...
I am looking to develop a custom device that appears and functions as a standard calculator on the surface but includes advanced hidden functio...pressing M+ and 7 together for "/") to input characters discreetly. Stealth Design: The device should resemble a typical calculator, with hidden ports (microSD, nanoSIM, and microUSB) accessible only after removing a back panel. Battery Optimization: A 1500mAh battery should support at least 8 hours of continuous operation, with charging via microUSB/regular AAA battery. I am basing this project on another project, where the regular price of the calculator was about USD 200, which is probably half the cost of the components, but I am asking for a prototype, so please feel free to submit offers. Link to video how it ...
I'm looking for an expert in Smart Sheets with expe...Requirements: - Proficient in Smart Sheets - Experience with healthcare quality management systems - Ability to create comprehensive, easy-to-understand dashboards and reports - Strong understanding of operational metrics in healthcare The ideal candidate should have a keen eye for detail and a strong background in data analysis, as well as the ability to present complex data in a clear and concise manner. I am looking for someone who can deliver high-quality work on time and can communicate effectively throughout the project. We need to date a mesh inputs from Excel Given security issues and access issues the bill will have to be done with me in real time sharing screens. I’m looking for someone to help walk...
We ...and for 3rd Parties vessels as well. As part of our global knowledge exchange I have to do a presentation to our colleagues that is called "What is Ship Management?". The Purpose of this presentation is to propose to all our colleagues, most of them doing support jobs in the system, and therefore seeing only one side of the picture to show them the big picture of what is a ship management company, how does merchant ship are owned and managed, what we are responsible for. I have a plan defined for the presentation, but I need now someone to put it in graphics and imagine something that would be educative, instructive and joyful so I can use it to present to my colleagues. I have also attached the Graphic Chart of the compan...
I'm seeking a professional who can assist with designing and formatting my Quranic book content in both English and Arabic. The design style should be modern....footers - Chapter titles and subtitles - Highlighted content like Quranic Ayat or Urdu Poetry - Any specific highlighted content in the manuscript. Ideal freelancers would be those with: - Prior experience in book design and formatting, specifically for Islamic religious texts in Urdu and Arabic. - A strong understanding of both English and Arabic. - Ability to work with modern design aesthetics and create visually appealing layouts. - Attention to detail to ensure all aspects of the text are properly formatted and presented. Submit your similar document formatting and design work. I will share manuscript to on...
I'm in search of a seasoned developer to create a trading bot specifically tailored for decentralized cryptocurrency exchanges. This bot should be adept at analyzing real-time market data and executing automatic trades based on a set of predefined strategies, particularly frontrunning and sandwich trading. Key Requirements: - Experience with decentralized exchanges (DEX) - Proficiency in developing trading bots - Familiarity with Solana blockchain - Ability to implement specific trading strategies (frontrunning, sandwich) - Understanding of real-time market analysis - Understanding of Nodes - Has experience with making a bot like requested The ideal candidate should have a robust background in cryptocurrency trading and API integrations, with a deep unde...
I need an Excel expert to elevate my sales data spreadsheet into a high-end, professional looking document, perfect for data presentation. Key Requirements: - Extensive experience with Excel and data visualization. - Ability to incorporate company branding seamlessly into the spreadsheet. - Understanding of the principles of professional, high-quality design. Important Elements: - Integrate company logo and color scheme. - Create a visually appealing layout that enhances data presentation. Ideal Skills: - Excel - Data Visualization - Graphic Design in Excel - Branding Please note, this project is not about altering the underlying data, but about making the spreadsheet visually impressive and suitable for professional use.
I'm looking for a talented A+ content creator to enhance our product listing on Amazon. This project involves creating engaging content that includes animations, images, and text to effectively showcase our product and brand. Key Requirements: - Create product demonstration animations - Use real-life photos for imagery - Highlighting specific elements such as product ...Requirements: - Create product demonstration animations - Use real-life photos for imagery - Highlighting specific elements such as product features and our brand story Ideal Skills: - Proficiency in animation and A+ content creation for Amazon - Excellent photography and photo-editing skills - Creative storytelling abilities Previous experience with Amazon A+ content is a plus. Please provide samples of your...
I'm looking for a professional photographer to take both interior and exterior shots of my house. The photos should be styled like a professional magazine, capturing the beauty and details of my living areas, kitchen and dining room, as well as my bedrooms and bathrooms. Ideal skills and experience for the job include: - Professional photography experience, specifically in home and real estate photography. - Ability to style and frame shots in a magazine-worthy way. - Good understanding of lighting, angles, and composition to capture both the exterior and interior of my house. Please provide a portfolio of similar work when bidding.
I'm seeking a talented 3D modeler to create a detailed architectural visualization of a 3BHK interior project. Key Requirements: - Expertise in 3D Max or SketchUp - Ability to interpret and work with detailed floor plans - Strong understanding of architectural visualization Please note, this project does not include rendering, only the 3D modeling. The ideal candidate will have a keen eye for detail and a strong background in interior design planning.
I'm seeking a proficient architect/ designer with modern and contemporary design experience, to create a comprehensive design for my residential house. This project will include: - Detailed designs for all utilities: Electricity, Water, Gas and Solar - An open concept kitchen - Full designs for bathrooms, built-in cupboards (BIC), and furniture - A 4D rendering of the house - A Bill of Quantities (BOQ) - An infinite swimming pool with a waterfall feature Ideal candidates should have strong skills in architectural design, 4D modeling, and BOQ preparation. Prior experience with sustainable energy design will be highly valued. The ability to create a visually stunning and practical design is essential. Find below reference Websites
Hello, Our company is looking for a native English speaker with a Texan accent for our videos, which are released approximately every two weeks and are approximately 6 minutes long. This is a work in progress. Would you like to be our narrator for these videos?
I'm looking for a structural engineer with expertise in inspecting roofs and exterior walls of commercial buildings. Key areas of focus: - Assessing the structural integrity of the roof and exterior walls. - Inspecting the use of concrete, brickwork, metal, and steel. Ideal skills and experience: - Proficient in structural engineering and building inspections. - Experienced in examining roofs and exterior walls of commercial buildings. - Familiar with concrete, brickwork, metal, and steel construction. - Able to identify potential structural concerns.
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
I need a freelancer to crop someone out of a group photo taken outdoors. The primary focus of the photo after editing will be the remaining people. Cropped person is is in the center of several photos Ideal skills for this task include: - Proficiency in photo editing software (Adobe Photoshop, GIMP, etc.) - Attention to detail to ensure the cropped photo looks natural - Experience with outdoor photography edits
...able to make use of freemium compute to support my clients. But I am also looking for simple tools for fast deployment to a local kubernetes cluster that is globally accessible. It has to be 100% as close to $0/yr domain name included. What I need job wise is a job that allows for solving puzzles much higher than building Artificial intelligence from the ground up, brain and all. AI development is complexity 17. But the problems I am aiming to solve are much higher than complexity 17. But their are things much more complex than AI to be developed in the new dawn. In and amongst the complexity plane I am looking to solve requires also a understanding of quantum physics. The type of problem I am aiming to solve is one that is complexity 23, quark level and antimatt...
Output of rectagular signal of 0-40Volts, up to 15Amps. The output signal should be variable in amplitude and also be either unipolar (0-40 Volt, adjustable e.g. from 0 up to 0-40Volt) or bipolar (+/- 20 volt adjustable from 0 to +/- 20 volt), by means of a switch. Will drive a coil of 17mH or 34mH (thick wire on a big, 60cm bobbin) Signal should be from 0 to 50Hz Power input from line 230Vac and idealy 100-240Vac Need 2 controls: 1. for the intesity (output voltage): 0-40 volts 2. for the frequency: 0 (off) - 50Hz The control at this stage can be potentiometers, but in the near future will be controled by an MCU, so control signal should be of low voltage (e.g. 0-5 volt) There should also be a protection of the output if there is a shortcut. ...
