Causes of third battle of panipatJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 causes of third battle of panipat jobs fundet

    In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...

    €40 Average bid
    €40 Gns Bud
    12 bud

    The creation of a virtual office

    €158 Average bid
    €158 Gns Bud
    4 bud

    ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish

    €194 Average bid
    €194 Gns Bud
    4 bud

    Hi, We need general text about flights. Written in simple, understandable sentences. Length: 3000 signs with spaces or 450 words Theme: 4 paragraphs about 1. Travel by plane - it’s safe, fast, cheap and comfort 2. When is the best moment for ticket reser...continental and intercontinental) and others. 4. What can I take to plane (to hand luggage)? (eating, drinks and others) What we want: • We like keywords: cheap flights, cheap tickets. It would be great if you will use them two or three times. It’s nice, but not necessary. What we want avert: • Please don’t use brands online travel agency, flight search engines. You may use brand of the most popular airlines in third paragraph. • Please don’t write about something terri...

    €334 Average bid
    €334 Gns Bud
    10 bud

    Logo designing

    €72 Average bid
    €72 Gns Bud
    21 bud
    €12 / hr Gns Bud
    4 bud
    Build of models
    Udløbet left

    Autocad designing

    €270 Average bid
    €270 Gns Bud
    6 bud
    Design project
    Udløbet left

    Jeg har brug for noget grafisk design Hej. Jeg skal have lavet et grafisk design til en spilleplade til mit brætspil. Der er et udkast, men ellers er der frit slag til at lave noget virkelig fedt. Temaet er fantasy, og der skal tegnes en kamp arena med 6 zoner, hvor heltene ...Jeg skal have lavet et grafisk design til en spilleplade til mit brætspil. Der er et udkast, men ellers er der frit slag til at lave noget virkelig fedt. Temaet er fantasy, og der skal tegnes en kamp arena med 6 zoner, hvor heltene kan udkæmpe episke slag :) Hvem er jeg: Uddannet lærer med speciale i spildesign. Jeg er netop i gang med at starte eget firma, og arbejder på det første projekt, battle arena, som nu er klar til at få et løft rent grafisk, s&ar...

    €103 Average bid
    €103 Gns Bud
    6 bud

    COPY OF AN ECOMMERCE SITE NEED My budget 30 usd

    €28 Average bid
    €28 Gns Bud
    2 bud

    Design A Catalog Of Products (1 Page)

    €17 Average bid
    €17 Gns Bud
    12 bud
    €29 - €29
    0 bud

    /findtranscript/ error.. pls fix

    PHP
    €18 Average bid
    €18 Gns Bud
    17 bud

    poster for online posts 3 pictures Bold

    €21 Average bid
    €21 Gns Bud
    13 bud

    Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

    €146 - €439
    €146 - €439
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €146
    €18 - €146
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud

    We want Remote Desktop software (for Mac & Win) like Team Viewer with all its functionality. Please send us ALL THE FEATURES and specification of what you will be providing. Along with the FINAL PRICE Note: 1. Complete and PROPER Source Code with documentation required. 2. No Copyright Script or GPL script. 3. No third-party tools.

    €240 - €721
    €240 - €721
    0 bud

    Tunne a linux server

    €144 - €144
    €144 - €144
    0 bud

    im looking for an estimate on creating a cad drawing of the ring that i uploaded

    €29 - €240
    €29 - €240
    0 bud

    As per skype conference

    €433 Average bid
    €433 Gns Bud
    1 bud

    Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...

    €385 Average bid
    €385 Gns Bud
    5 bud

    ...About Math Fighter! Math Fighter! is a Street Fighter-inspired educational game where players select a character and battle opponents by answering multiple-choice math questions. The game features single-player, online multiplayer, unlockable characters, and story progression. What We’re Looking For: ✅ Exceptional animation skills with a strong sense of color and movement ✅ Ability to capture the bold, vibrant aesthetic of 80s/90s arcade games (Think Sonic 2, Street Fighter, and the Marble Zone from Sonic 1) ✅ Experience using a digital drawing pad for all designs ✅ A portfolio with at least 5 samples showcasing animation, character motion, or trailers ✅ Experience in one or more of the following software: Blender Adobe Animate Toon Boom Your Role: ✅ ...

    €114 Average bid
    €114 Gns Bud
    10 bud

    ...Responsive for various devices. **Development Timeline:** - Discovery & Design (2-4 weeks) - Development (8-12 weeks) - Testing (3-4 weeks) - Deployment (1-2 weeks) - Ongoing Support (post-launch) **Budget:** Includes development, design, third-party integrations, testing, and maintenance. **Selection Criteria:** Experience in mobile app development for similar industries, competitive pricing, and strong references. **Submission Guidelines:** Submit proposals by [date], detailing approach, timeline, and costs. --- This summary gives a clear overview of the project scope, features, timeline, and submission guidelines....

    €692 Average bid
    €692 Gns Bud
    85 bud

    ...need a talented virtual stager to create a classic elegant design for the living room of a rental unit. The VS photos should be modern high-end, using a palette of white and neutral colors to match the interior. The job has to be completed within 4 hours. 4 Photos: Living Room, Dining Room, Master Bedroom, and a Basement Living room (for rental) Key Requirements: - Design and stage a living room, dining room, bedroom, and basement living room. - Use of high-end, white & neutral color scheme for Main Living, Dining & Master Bedroom - Use of regular model style for Basement Living room. (please make it a dining + living, where closer is dining. because the photo is taken from the kitchen) - Inclusion of artwork in the living room design....

    €131 Average bid
    Haster
    €131 Gns Bud
    12 bud

    I need an experienced developer to set up a comprehensive, secure sign up and login system for my CRM. The system sho...media logins (Google, Facebook, LinkedIn) and Two-Factor Authentication for heightened security. - A user role management system with different roles and permissions, enhancing access control and data security. Ideal candidates for this project should have extensive experience with CRM systems, user authentication, and role management. Proficiency in integrating third-party services is crucial, as well as a deep understanding of security protocols to implement Two-Factor Authentication effectively. This project is not just about setting up a login system; it’s about creating a robust, secure, and user-friendly experience for CRM users with varying r...

    €13 Average bid
    €13 Gns Bud
    14 bud

    ...credibility with potential clients by showcasing our satisfied customers. - Create detailed service description pages for each type of home repair. - Ensure the website is fully responsive for an optimal mobile experience. - Integrate secure payment gateways to allow for online payments. - Add a Frequently Asked Questions section to address common customer queries. - Include a Live Chat Support feature to help customers get instant assistance. Ideal skills for this job include web development, UI/UX design, and an understanding of eCommerce systems. Experience with creating similar service-based websites will be a significant advantage. Please provide examples of previous work that aligns with these requirements. The website should feature a vibrant and colorful t...

    €138 Average bid
    €138 Gns Bud
    47 bud

    ...be suitable for low wind speed conditions. Other aspects required to be provided by the designer are as under: 2. Technical Specifications Blade Dimensions, Height Diameter , thickness and profile details need to be provided by the designer Blade Shape & Airfoil Profile: Mention any specific airfoil section (e.g., NACA profiles like NACA 0018, NACA 0021) Blade Material: Suggested material Number of Blades: Define whether it is a two-blade, three-blade, or multi-blade design Mounting & Connection Details: Provide details on how the blades will be fixed to the turbine Structural Reinforcement: If any reinforcement or stiffeners are required 3. Design Requirements Aerodynamic Considerations: Should improve torque efficiency Weight Considerations: Lightweight but strong t...

    €368 Average bid
    €368 Gns Bud
    21 bud

    I have an 8,000-word paper in English that needs attention. Specifically, I want all citations and references to be uniform and flawless. The paper is currently formatted in Chicago 17th edition, which should be thoroughly reviewed and double-checked for accuracy. Additionally, I would like a copy of the paper reformatted in APA style. Along with these adjustments, I would appreciate a thorough proofreading of the entire paper.

    €16 / hr Average bid
    €16 / hr Gns Bud
    42 bud

    ...be suitable for low wind speed conditions. Other aspects required to be provided by the designer are as under: 2. Technical Specifications Blade Dimensions, Height Diameter , thickness and profile details need to be provided by the designer Blade Shape & Airfoil Profile: Mention any specific airfoil section (e.g., NACA profiles like NACA 0018, NACA 0021) Blade Material: Suggested material Number of Blades: Define whether it is a two-blade, three-blade, or multi-blade design Mounting & Connection Details: Provide details on how the blades will be fixed to the turbine Structural Reinforcement: If any reinforcement or stiffeners are required 3. Design Requirements Aerodynamic Considerations: Should improve torque efficiency Weight Considerations: Lightweight but strong t...

    €93 Average bid
    €93 Gns Bud
    6 bud

    ...issue, suggesting improvements, and implementing necessary changes to ensure my emails reach the intended inbox. Please share your relevant experience and proposed strategies to tackle this issue. The primary recipients of my emails are public domains such as Yahoo, Outlook, etc. I have currently implemented SPF, DKIM, and DMARC. The email volume is moderate, with emails being sent weekly. The emails primarily contain transactional content. The email content has been reviewed for elements that might trigger spam filters. The emails are currently being sent through a third-party service like Mailchimp. No need for assistance with email content optimization as the content has already been reviewed and deemed appropriate. This project needs to be completed urgently, within...

    €248 Average bid
    €248 Gns Bud
    4 bud

    I'm experiencing random gateway errors on my Wordpress site. I haven't installed any new plugins or themes recently. The errors occur sporadically without a clear pattern. Ideal skills for this project: - Extensive experience in troubleshooting Wordpress issues - Proficient in coding and debugging - Familiar with gateway errors and their potential causes - Able to provide a long-term solution to prevent recurrence.

    €88 Average bid
    €88 Gns Bud
    58 bud

    ...user update his profile the unit manager and division manager should get email. Able to upload his own photo (this is not part of Active directory should not upload from there) Note: if the user update his profile it should sync to active directory as well " to update the user profile the system should talk to active directory using the creditials i will provide to you otherwise it will not update" KEEP IN MIND THIS PART 2nd pages is contain 3 icon - first icon is directory we will map the main directory where all user is connected second icon is department directory - this similar to directory but the only different this going to be filter base on department OU third Icon My profile he will be redirect on the 1st pages When the user select any one on directo...

    €121 Average bid
    €121 Gns Bud
    26 bud

    I'm in need of a seasoned developer who can install, configure, and customize the PICO MSG bulk SMS script for an SMS marketing platform. The task is to create a secure, intuitive website where users can purchase SMS credits, send bulk messages, and manage their campaigns. Key Requirements: - Integration with multiple SMS gateways: Twilio, Nexmo, and Plivo - Incorporation of primary payment systems: PayPal and Stripe for SMS credits purchase - Basic branding customization: applying our logo and colors to the platform This project demands a professional with extensive experience in SMS script customization, web development, and third-party service integration. The ideal candidate would be able to deliver a fully functional, user-friendly platform tailored to our...

    €623 Average bid
    Haster NDA
    €623 Gns Bud
    37 bud

    I'm looking for a data vendor who can provide a list of homeowners in Los Angeles, California, who have expressed interest in home improvement within the last two weeks. The list should include: - Name and contact details - Property details - Type of home improvement needed - List phone numbers for quick contact. Please deliver the list in an Excel spreadsheet. Ideal candidates for this project should have experience in data collection and analysis. They should be able to provide accurate, up-to-date information in a timely manner. Knowledge of the home improvement sector would be a plus.

    €327 Average bid
    €327 Gns Bud
    20 bud

    We are inviting experienced software developers or development teams to create a sophisticated online marketplace platform dedicated to the trading of digital products using advanced security and payment solutions, including cryptocurrencies. Technical Requirements: Programming Language: PHP Database: MySQL Consideration of using a modern framework such as Laravel or Symfony Development to be conducted in phases with payments tied to milestone approvals. Core Features: - Product listing functionalities with categories and advanced search capabilities. - User profiles with rating and review systems to foster a reliable community. - A secure transaction mechanism that includes an escrow system to protect both buyers and sellers. - Automated updates to user wallets when tran...

    €17 / hr Average bid
    €17 / hr Gns Bud
    49 bud

    ...for development of excel spreadsheet tool for financial projections, scenario analysis and presentation materials for same. Spreadsheet function is to calculate cash position and standard EBIT/EBITDA information from 2023 to 2040 (pre-revenue through profitability) for a (renewable energy) technology development and licensing company: not manufacturer, not a software developer, nor SAS provider. The basic financial structure includes simple operating cost structure, project-based revenues, non-operating income, minimal capex and equity infusion. Project Revenue Types are: • License payments based on milestones related to tangible progress for design, construction and commissioning of commercial and annual annuities (royalties) based on plant capacity (or annual...

    €721 - €1443
    Haster Forseglet
    €721 - €1443
    42 bud

    Project: Mobile Productivity Tool Software Patent Title of the Invention "Integrated Mobile Productivity Tool for Enhanced Workflow Management and Task Optimization" Field of the Invention: This invention relates to software solutions designed for mobile devices, specifically targeting productivity enhancement. The system integrates task management, time tracking, collaborative tools, and AI-powered analytics to optimize user workflows and improve task execution efficiency. Background of the Invention: With the growing dependence on mobile devices, professionals and individuals increasingly rely on mobile applications to manage their daily tasks. However, existing solutions often lack comprehensive integration of task scheduling, collaboration, and p...

    €27 / hr Average bid
    €27 / hr Gns Bud
    9 bud

    ...WordPress designer and developer who can assist with a variety of client projects, primarily focusing on the layout and functionality of aesthetic clinic websites. This role requires someone who is experienced, flexible, and detail-oriented, with the ability to handle evolving tasks based on client needs. Key Responsibilities: • Designing and optimizing page layouts as needed • Implementing SEO strategies, including adding CSS headings, snippets, links, meta descriptions, and indexing pages on Google • Managing and exporting/importing forms using Gravity Forms • Updating, adding, or deleting pages, including event pages and other time-sensitive updates • Managing task workflows and collaborating on project priorities • Dealing with t...

    €13 / hr Average bid
    €13 / hr Gns Bud
    150 bud

    End User Interface User auth Login with email and password Signup Name Email Address Phone number OTP confirmation for email Home Devices: Online/Offline ON/OFF Device Control Color Live Color Create a design (pattern) All devices Profile Contact the admin via email to update the profile Not Editable Name ...registration Admin User interface Can create/delete user Name Email Address Phone number Add an installer Name Email Phone number Address Provioson a new device: Model number Mac address User email address Setup device 4 - Zones Bulb settings IC name color sequence - RGB, BGR, etc Assign a device to the user. Approve the device Every user must have a user number. Date of installation/creation for device Voice recognition (can be seen under third-party integration in th...

    €80 Average bid
    €80 Gns Bud
    1 bud

    I'm looking for a professional to review a high-level contract from a ri...perspective, with a particular focus on any risks associated with internal controls and personal data law. Key areas of focus: - Identifying potential risks within business processes - Evaluating the robustness of the contract in mitigating these risks - Assessing the adequacy of internal controls as stipulated in the contract The ideal freelancer for this project should have extensive experience in risk management, personal data protection law particularly in assessing all risks within contracts. A strong understanding of internal controls and how they can be impacted by contractual terms is crucial. Please bid only if you have relevant experience and can provide examples of...

    €114 Average bid
    €114 Gns Bud
    9 bud

    ...flight training institute in Switzerland. The goal is to elevate the site's overall look, feel, and functionality to match our high-quality service. Key aspects of the project include: Creating a modern, sleek visual style for the site, which will involve a comprehensive redesign. The focus will be primarily aesthetic. The site will serve as a landing page that conveys the quality of our services. The design should reflect the essence of Switzerland—precision, quality, and unmatched craftsmanship—tailored to deliver a user experience that embodies the Swiss commitment to excellence and innovation. We have decided to integrate a third-party provider for the student portal and calendar to streamline the website's complexity, allowing th...

    €1018 Average bid
    €1018 Gns Bud
    142 bud

    With the earlier design you did with the optlife logo there is a new version we would like. Same grapical objects, adding a few and then adding a new text. Sketch is done, same colors, objects and so as the last one. Some small creativity parts to add a cabin and an simple siluette of a mountain. The cabin should pop from the rest of the logo

    €17 Average bid
    €17 Gns Bud
    1 bud

    We are looking for an experienced DMCA removal expert or a lawyer who specializes in copyright takedown requests. Our copyrighted content has been unlawfully published on third-party websites and appears in Google search results. We need a professional who can: Identify and document infringing URLs. File DMCA takedown notices with Google and web hosts. Handle legal procedures if necessary. Ensure successful removal of our content from search results. Provide a report on actions taken and results.

    €101 Average bid
    €101 Gns Bud
    4 bud