Causes and effects of partition of indiaJobs
I’m looking for 6 new business partners! Are you looking for a new income? Do you want to spend more time with your family? Do you want your dreams come true? I’m looking for 6 new open minded people who want a serious business and have a Dream working from home. * you decide when and where to work * We’ll teach you how to do * Reach your biggest dreams Are you ready to open up India and Europe? I can’t answer messages in here. (removed by Freelancer.com admin)
The creation of a virtual office
i have ready files to be edited
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
Cli routes for india Digitil routes for india Pak non cli Bd non cli Egypt non cli
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
Move the current website to Siteground.
I'm looking for a proactive virtual assistant based in India who excels in team management and organizational skills. The main objective of this project is to manage the collection of 20,000 high-resolution (1920*1080) exterior car photos. Payment: - I offer $0.05 for every photo that meets the requirements.
I'm in need of a skilled VFX and CGI professional to enhance a dramatic moment in my video. The main focus is to use these effects to deepen the storytelling and engage viewers on an emotional level. Key Requirements: - Expertise in creating VFX and CGI that can effectively amplify emotional expressions. - Proficiency in designing unique visual transitions that can seamlessly blend with the narrative. Ideal Skills: - Strong background in VFX and CGI, particularly in enhancing storytelling. - Excellent understanding of emotional pacing and visual storytelling. - Proven track record of designing VFX and CGI for dramatic moments. I look forward to seeing your proposals and discussing how we can collaborate ...
Project Title: 3D Animation of Waste Pond Transformation for Rural Development Project Description: We are looking for a skilled freelancer or team to create an interactive 3D animated model showcasing the development of a waste pond in rural India. The current site is an unmanaged waste pond, and we envision transforming it into a well-planned recreational area with various civil features. The final deliverable should include an interactive animation that illustrates the following features as part of the development: Example, ramps and Staircases: Add realistic staircases leading to different areas. Sitting Areas: Design comfortable, aesthetically-pleasing sitting areas for public use. Playground for Kids: Include a well-designed playground are...
My existing logo is in JPEG format and I need it converted into a high-quality format using Adobe Illustrator. The logo does not need any design changes, just a professional, high-resolution vector version suitable for print materials. Ideal Skills: - Proficiency in Adobe Illustrator - Graphic design experience - Logo design and conversion expertise Please, no design alterations, just a high-quality version of the existing logo.
Domain Authority (DA) score of 40+ Services for this websites: 1. 120$ per website - as agreed.
...New Delhi, India. We sell kathi rolls, momos, kebabs and chinese (like rice & noodles). Our food is tasty. I'm looking for an expert in marketing with a focus on boosting sales for my food outlet. The target sales channels primarily include in-store purchases and delivery through third-party apps. Key focus areas: - In-store sales: Develop strategies to attract more customers to the outlet and increase per-customer spending. - Third-party delivery services: Create initiatives to enhance visibility and sales through popular delivery platforms. - How to use online platforms as Zomato, Swiggy etc effectively? The ideal candidate should have extensive experience in the food industry and a proven track record of increasing sales th...
...a 17-year-old entrepreneur from India, seeking an experienced immigration lawyer to help secure a visa to the U.S. I aim to develop innovative solutions and connect within the tech industry. Key Requirements: - Visa Expertise: I need assistance to identify the most suitable visa options (Entrepreneur, Employment, or a Student Visa with work option) for my situation. - Application Preparation: I want my application to effectively showcase my achievements, including helping a client generate $60,000 in revenue over 7 months and my work on an AR 3D hologram phone. - Legal Compliance: It's crucial that I meet all legal requirements throughout this process. Ideal Skills: - Expertise in immigration law with a track record of securing visas for entrepreneurs ...
If you don't read and fully understand this brief... you won't be successful with your entry for the contest. So read all of the following carefully. I'm on the hunt for a skilled video editor to elevate my YouTube content. I need full production services including the integration of my existing branding materials - a logo and color scheme - into animated intros and outros. Key requirements: - Expertise in video editing with a focus on YouTube content - Proficiency in creating full-scale video productions with advanced effects - Ability to incorporate animated graphics seamlessly into the videos Ideal candidate will understand how to enhance viewer engagement and retention through high-quality editing and production...
I'm in need of a skilled photo and video editor to enhance my content for social media. Ideal Skills: - Photo Editing: Proficiency in software like Adobe Photoshop, Lightroom, etc. - Video Editing: Experience with software like Adobe Premiere Pro, Final Cut Pro, etc. - Understanding of social media trends and requirements for photo and video content Please note, there's no specific requirement for cropping, color correction, adding transitions or effects, etc. I trust your expertise to enhance them for social media without needing to specify particular edits.
I'm seeking a Business Development Executive, focused on the Technology industry, to help grow my business in India. This is a remote, flexible hours role, with compensation based on a percentage of revenue generated. Key Responsibilities: - Lead generation: Identifying and reaching out to potential clients and partners - Revenue growth: Contributing to the company's bottom line through successful business development strategies Ideal Candidate: - Proven experience in business development, particularly within the technology sector - Strong understanding of the Indian market - Excellent lead generation skills - Results-driven, with a focus on revenue growth Please note, this role is commission-based, offering unlimited earning potential for th...
I'm looking for a skilled 3D artist to create a high-poly, realistic-textured 3D model of a product with 6 colour variations. The project includes: - 3D Modeling: Create a high detail model of a product. - Texture and Lighting: Apply realistic textures and suitable lighting to enhance the model's appearance. - Compositing and Effects: Use compositing techniques to create visually appealing scenes with the model. - Colouring for up to 6 models: Create 6 different colour variations of the model. Ideal skills for this project include: - Proficiency in 3D modeling software (e.g., Blender, 3ds Max, Maya) - Strong understanding of texturing and lighting - Experience with compositing and effects - Ability to...
...Money Minds, where I share trading strategies and online earning methods. The ideal candidate would be a long-term collaborator who can produce videos similar to DECODING YT, complete with engaging thumbnails. Key Responsibilities: - Edit fast-paced videos with numerous cuts and transitions - Incorporate text overlays and subtitles - Add background music and sound effects - Utilize stock footage and images Ideal Skills: - Proven experience in video editing, preferably for YouTube content - Ability to create engaging, fast-paced edits - Experience with creating thumbnails - Familiarity with trading or finance content is a plus I'm open to considering new freelancers, provided you can demonstrate your editing skills and creativity. ...
I'm seeking expert assistance to check the availability and register my business slogan as a trademark in India. Key Requirements: - Conduct a comprehensive search to confirm the slogan's availability. - Handle the entire trademark registration process on my behalf. - Provide regular updates and ensure clear communication throughout. Ideal Skills: - Prior experience with trademark registrations, particularly in India. - Excellent research skills to ascertain slogan availability. - Strong communication skills for regular updates and clarifications. - Knowledge about the intricacies of trademark law and procedures. Your expertise will help protect my brand and ensure its unique presence in the market.
...images of hardwood timber posts and beams from stock photos for Google Shopping. Key details: - We have around 15 different types of timber, totaling 106 images. - Each image needs to be supplied in two different resolutions: 1270 x 954 and 800 x 800. - The images must match the product descriptions. This includes scaling product size, color, and image representation to correspond with the specific timber type. - All images will have a white background. - The images should be taken from an angled view. - No special visual effects are needed for any of the timber types. Ideal skills and experience include: - Proficiency in photo editing software. - Experience in product image enhancement. - Understanding of eCommerce image...
I'm seeking a designer to give our website a fresh, bold and vibrant visual design. The main objective of the redesign is to update the visual style of the site, making it more engaging and exciting for our users. Key Pages for Redesign: - Founder's Page - About Us - Contact - E-commerce Section - Revision Page Ideal Candidate: - Proficient in modern web design principles. - Experience with creating bold and vibrant visual styles. - Familiarity with e-commerce website design. - Able to deliver a comprehensive redesign of multiple website pages.
I'm seeking a seasoned telemarketing professional with a proven track recor...seasoned telemarketing professional with a proven track record in lead generation, customer retention, market research, and closing deals. Your primary responsibilities will include: - Reaching out to potential leads and closing deals. - Retaining and engaging all types of customers: existing, previous, and newly acquired. - Conducting market research to identify new opportunities and trends. - Telemarketing to large corporations specifically. Ideal candidates should have extensive experience in telemarketing targeting large corporations, with excellent communication and negotiation skills. Proficiency in market research and customer service is a plus...
... video editing, and logo design, helping businesses and individuals establish a strong online presence. Website Development A well-designed website is essential for any business. I create responsive, fast, and user-friendly websites that align with your goals. Whether you need a portfolio, e-commerce site, or business website, I ensure a sleek design, smooth navigation, and SEO optimization. Your website will be mobile-friendly, secure, and visually appealing to attract more visitors and convert them into customers. Content Creation Content is key to engaging your audience. I provide compelling blog posts, website copy, social media content, and product descriptions that capture attention and drive traffic. My content is tailored...
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
As a client, I am looking for a detailed SQL database of all Indian medicines and OTC products. I am also attaching a sample file it should contains all the fields from sample files. This database should include: - Brand name, generic name, and price - Ingredients and usage instructions - Side effects and contraindications - An image of the product The database should also be categorized or classified by: - Type of medicine - Manufacturer - Treatment category Ideal candidates for this project should have experience in data collection and database management, particularly in the pharmaceutical or healthcare sectors. Knowledge of SQL and an understanding of medicine classification systems will be highly b...
I'm l...the trailer. This is for the 5 year anniversary of the film which is going to be put in an exclusive DVD version of the film. The project will require not just dubbing, but also translating the script from English to Hindi. Ideally, you'd use AI voices that are comparable or superior to the original English actors. Would also Key Requirements: - Film duration: 30 to 90 minutes - Genre: Action - Script: Needs translation from English to Hindi - AI Voice Dubbing: Voices should match or exceed the quality of the original actors Skills & Experience: - Proficient in Hindi and English - Experience in film script translation - Knowledge of AI voice dubbing - Prior work in action film dubbing preferred Please provide samples of you...
Update for android dating app with php server side
I'm in need of a talented web developer with a knack for creating sleek, modern, and user-friendly e-commerce sites. The website will be selling physical goods and must be capable of securely processing online transactions. Preference will be given to freelancers based in Kolkata, India. Key Features: - Payment Gateway Integration: The website needs to incorporate Razorpay, ensuring a secure and efficient payment system. - Shopping Cart: A seamless, intuitive shopping cart experience is critical to the success of this project. - Customer Reviews: An integrated system where customers can leave product reviews is a must. Ideal Skills: - Proven expertise in developing e-commerce websites. - Extensive experience with Razorpay integratio...
