Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 bill of materials jobs fundet

    The creation of a virtual office

    €159 Average bid
    €159 Gns Bud
    4 bud

    ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish

    €196 Average bid
    €196 Gns Bud
    4 bud

    Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid

    €149 Average bid
    €149 Gns Bud
    5 bud

    Logo designing

    €73 Average bid
    €73 Gns Bud
    21 bud
    €12 / hr Gns Bud
    4 bud
    Build of models
    Udløbet left

    Autocad designing

    €273 Average bid
    €273 Gns Bud
    6 bud

    COPY OF AN ECOMMERCE SITE NEED My budget 30 usd

    €28 Average bid
    €28 Gns Bud
    2 bud

    Design A Catalog Of Products (1 Page)

    €18 Average bid
    €18 Gns Bud
    12 bud
    €29 - €29
    0 bud

    /findtranscript/ error.. pls fix

    PHP
    €19 Average bid
    €19 Gns Bud
    17 bud

    poster for online posts 3 pictures Bold

    €21 Average bid
    €21 Gns Bud
    13 bud

    Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

    €148 - €444
    €148 - €444
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €148
    €18 - €148
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud

    im looking for an estimate on creating a cad drawing of the ring that i uploaded

    €29 - €243
    €29 - €243
    0 bud

    As per skype conference

    €438 Average bid
    €438 Gns Bud
    1 bud

    Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...

    €389 Average bid
    €389 Gns Bud
    5 bud

    ...Spa-Like Logo for Organic Skincare Brand: BehrNaturals Description: We’re looking for a talented designer to create a minimalist, elegant logo for our organic skincare brand, BehrNaturals. Our brand specializes in affordable, organic tallow-based skincare products for families. We want a logo that reflects the purity, simplicity, and natural elegance of our products. This logo will be used on our store’s website, organic packaging, and marketing materials. It should convey a spa-like aesthetic and align with our brand's natural and organic theme. Design Guidelines: Style: Minimalist, clean, and elegant Spa-like with a focus on natural elements Avoid clutter or overly complex designs Colors: Neutral, organic tones (e.g., beige, soft greens, earthy brow...

    €97 Average bid
    Garanteret
    €97
    8 indlæg

    I'm looking for a talented 3D artist who can create realistic models of anthropomorphic animals. Ideal Skills and Experience: - Proficiency in 3D modeling software (e.g. Blender, Maya) - Strong understanding of animal anatomy and movement - Experience in creating realistic 3D models and textures - Ability to design anthropomorphic traits without losing realism - Good communication skills to understand project requirements and provide updates photos of previous works are required.

    €103 Average bid
    €103 Gns Bud
    22 bud

    ...with diverse special needs. Key Focus: - The primary aim of our learning center is academic improvement. Therefore, the business plan should articulate how the center will facilitate this goal. - The center will cater to a wide age range, from early childhood (3-5 years) to teenagers (12-18 years). The plan should reflect an understanding of the unique needs and learning styles of these different age groups. The freelancer should have strong skills in market analysis, operational planning, and marketing strategy. Experience in the education sector, particularly in special education, will be highly beneficial. A thorough understanding of the special needs landscape and the associated market potential will be crucial to the success of this project. I...

    €1868 Average bid
    €1868 Gns Bud
    7 bud

    I'm in need of a branding identity that includes a unique, abstract-style logo and a complementary business card. The logo will primarily be used on print materials, so it needs to be designed with this in mind. Ideal skills for this project include: - Proficiency in graphic design software - Experience with abstract design - Understanding of print design specifications

    €251 Average bid
    €251 Gns Bud
    8 bud

    I'm looking for a freelancer based in either South or North America. Your role will primarily be to provide me with some needed resources or support. Ideal skills for this job include: - Good communication skills - Understanding of basic task execution - Ability to source relevant materials or support Please note, this is not a writing, design, or programming task. It’s about being a provider.

    €114 Average bid
    €114 Gns Bud
    6 bud

    I'm in need of a skilled mechanical engineer with a strong background in materials science, specifically focusing on understanding and solving problems related to the mechanical properties of various materials commonly used in construction.

    €21 Average bid
    €21 Gns Bud
    9 bud

    I'm seeking a graphic designer to create 5 title pages for a presentation/course. The domains a...company branding colors, and use our standard fonts. Domains: 1. Security Operations & Leadership 2. Defensive Tactics & Use of Force 3. Verbal Judo & Tactical Communication 4. Security First Aid for the Field 5. Emergency Management & Response Specific requirements: - Each title page should feature the Security Responder logo. - Each page should include the text "Domain" followed by the respective number. - Each page should include a corresponding picture (to be provided). Ideal skills for this job include graphic design, brand adherence, and a strong understanding of professional design standards. Experience in creating corporate presenta...

    €127 Average bid
    Garanteret
    €127
    29 indlæg
    Minimalistic Logo Completion
    6 dage left
    Godkendt

    I'm in need of a designer who can help me finish a half-done, minimalistic logo. The primary purpose of this logo is for brand recognition, product packaging and marketing materials. It needs to be monochrome as per the current design. Ideal Skills and Experience: - Strong graphic design skills - Experience with minimalistic design - Understanding of brand-oriented design - Ability to work with monochrome color palette - Proficient in design software like Adobe Illustrator or similar

    €23 Average bid
    €23 Gns Bud
    72 bud

    Same as the last project we need two versions, one with the "trim" of the door wood color and one with just the door handle handle

    €24 Average bid
    €24 Gns Bud
    1 bud

    I'm seeking a talented designer to create a minimalist style logo for me. The logo should be suitable for print materials and incorporate both text and icon-based elements. Key Requirements: - Extensive experience in logo design, particularly in a minimalist style - A strong portfolio of print-ready designs - Ability to create both text-based and icon-based elements within the logo - Proficiency in design software suitable for creating high-quality, scalable logos I'm looking for someone who can deliver a unique, professional logo that aligns with my vision and is ready for use in print.

    €15 Average bid
    €15 Gns Bud
    18 bud

    I'm seeking an architect with a keen eye for minimalist design and contemporary aesthetics. The project will focus on: - Design and Architecture: The primary emphasis will be on the overall layout and structural elements of the house, encapsulating a clean, uncluttered, and functional minimalist style. - Material Selection: The chosen materials for this project are concrete, brick (with steel reinforcement) and steel (beams if required). These should be integrated into the design in a way that highlights their inherent qualities, contributing to the minimalist aesthetic. Ideal candidates for this project should have: - Extensive experience in contemporary and minimalist design - Proficiency in designing with brick reinforced with steel and concrete. - A por...

    €1132 Average bid
    €1132 Gns Bud
    19 bud

    ...Sicily for a new construction project. The project requires a keen understanding of luxury and comfort, as well as the ability to create inviting, aesthetically pleasing spaces that will appeal to our guests. Key Areas for Design: - Guest Rooms: Each room should offer a unique, yet cohesive design that embodies the charm of Sicily, while catering to the expectations of high-end visitors. - Lobby/Reception Area: The main entrance of the villa must be welcoming, impressive and reflective of the brand's identity. - Dining Area: This space should be designed to offer an intimate yet luxurious dining experience. - Able to include decorative elements with a Sicilian theme. - Source and incorporate authentic Sicilian materials, such as ceramic t...

    €3526 Average bid
    €3526 Gns Bud
    39 bud

    ...me design and engineer the conversion of my Toyota Land Cruiser LX 1988 pickup into a fully functional tea truck. The project should include both the interior and exterior design, focusing on aesthetics, functionality, and practical implementation. Key Requirements: 1. Exterior Design: • Modern, attractive branding that aligns with a tea shop concept. • Creative use of the vehicle’s structure while maintaining its rugged appeal. 2. Interior Layout: • A functional workspace for tea preparation and serving. • Space allocation for storage, equipment, and utilities like a sink, small refrigerator, etc. • Integration of power and plumbing (suggestions for generators, batteries, or water tanks). 3. Technical Details: • Recomme...

    €352 Average bid
    €352 Gns Bud
    46 bud

    ...AI development focusing on integration with Canva API. - Tools should allow customization of colors, font sizes, logo images, and main pictures. - Utilize predefined templates for design parameters modifications. -------------------------------------- 1. Understanding the current operation and its issues (a) Current work content We recognize that the current workflow for banner production is roughly as follows. 1). Prepare product images, product descriptions, catchy copy, brand logo, etc. for the product for which you want to create a banner 2). Select a Canva template that matches the product image from a library of thousands 3). Decide on image size, text size, text color, and graphic materials 4). Create your own background image if necessary 5). Place each e...

    €1039 Average bid
    €1039 Gns Bud
    54 bud

    ...high-end, classic and sophisticated dog apparel brand. This brand will primarily focus on clothing and accessories, with the potential for future expansion. Key Requirements: - Design and develop a range of stylish and sophisticated dog clothing and accessories - Ensure all designs uphold the luxury standard of the brand - Create designs that can be adaptable for different dog sizes and breeds Ideal Skills: - Extensive experience in pet apparel design - A strong understanding of luxury fashion - Ability to design for a variety of dog sizes and breeds - Excellent knowledge of materials and fabrics suitable for luxury dog apparel The selected freelancer will have the opportunity to shape a unique brand in the pet apparel market. I need a whol...

    €249 Average bid
    Garanteret Forseglet
    €249
    426 indlæg

    Create a list of 300 total contacts in the Home Services sector, such as the following- electricians - plumbers - Handymen - Contractors - Pest control - Painters - etc.

    €194 Average bid
    €194 Gns Bud
    1 bud

    I'm seeking a skilled artist to create a detailed pencil or pen rendering of a greenhouse on a wooded site. Key Requirements: - The primary focus of the rendering will be the overall layout and ambiance of the greenhouse within its wooded surroundings. - The style of the rendering should be realistic, not sketchy or abstract. - The rendering should include a ground-level view perspective. Ideal Skills: - Proficiency in pencil or pen techniques. - Experience in creating realistic architectural renderings. - Ability to depict the integration of structures with their environments. I look forward to seeing how you can capture the beauty and serenity of this setting.

    €20 / hr Average bid
    €20 / hr Gns Bud
    40 bud

    I need a freelancer for SEO of my website. Experience holder and expert freelancers contact me who can do it perfectly. For digital marketing.

    €43 Average bid
    €43 Gns Bud
    38 bud

    I'm looking for a professional graphic de...Fountain'. The design should be minimalistic with a vintage style and a simplistic colour scheme. Key Requirements: - The logo must incorporate the bar's name and an icon or symbol based around the attached images of the steel Bessemer process. - The images of the steel Bessemer process are a part of the bar's heritage, so we need a logo that reflects both the image and the name, while being reduced to a more minimal and scalable design. - Further images are attached of vintage style logos we like. The logo should be versatile enough for use on signage, promotional materials and digital platforms, as well as on uniforms. The logo must prominently feature the name 'The Fountain' a...

    €102 Average bid
    €102 Gns Bud
    128 bud

    Mobile App Design of A Webview Project We have a parent panel. We have created an app from this parent panel. It's responsive but we want it to look like a real application. The technologies we used; - Metronic Theme 4: - Bootstrap v3 manipulated by Metronic Theme. First we want to see the mockups. After approving the mockups; - The developer must use the Metronic structure as much as possible. - Custom CSS and JavaScript The calendar in homepage is Full Calendar() After the second step, we will do a small applicability test and then finish the project. The current app to see;
 Google Play: 
 App Store:

    €501 Average bid
    €501 Gns Bud
    78 bud

    I'm looking for a skilled web developer and designer to create an educational website for me. The main purpose of the site is to provide courses and tutorials. Key features I want on the site include: - A user-friendly interface that can host a variety of educational content - The ability to provide downloadable materials for each course Ideal candidates for this project should have a strong portfolio in e-learning web design and development. Experience with creating sites that host downloadable content is a plus. Please provide examples of similar projects you've completed in your bid. Thank you!

    €263 Average bid
    €263 Gns Bud
    34 bud

    ...designer to create a comprehensive suite of materials for my election campaign with the ICAI. Design Materials: - Flyers and Brochures: These will be key for offline engagement and need to be visually appealing and effectively communicate my campaign's message. - Social Media Graphics: These will need to be designed for various platforms and should be shareable and engaging to help increase my online presence. - Posters and Banners: These will be used for on-ground campaigning and need to be bold and eye-catching. Branding: - I currently do not have a specific color scheme or branding guidelines for this campaign, so I will need your expertise in this area. The designs should all be cohesive and reflect a consistent visual identity. Tone: - The overall ton...

    €4 / hr Average bid
    €4 / hr Gns Bud
    11 bud

    ...minimalistic with a vintage style and simplistic in colour scheme. Key Requirements: - The logo must incorporate the bar's name and an icon or symbol based around the attached images of the steel Bessemer process. - The images of the steel bessemer process are a part of the bars heritage, along with the name of the bar being "The Fountain" - so we are looking for a logo that represents both the image and the name, whilst being reduced to a more minimal and scaleable design. - Further images are attached of vintage style logos we like the feel/style of. The logo should be versatile enough for use on signage, promotional materials and digital platforms, as well as uniform etc. I look forward to your proposals. The logo mu...

    €58 Average bid
    Garanteret
    €58
    675 indlæg

    I'm in need of a custom tech pack for a unique head covering clothing prototype. This piece is aimed at the everyday user, with a focus on being hygienic yet fashionable. The tech pack should feature separate designs for male and female, and include a holding pouch for clean and used items. Key elements to be included in the tech pack: - Free design consultation - Construction call-outs - Technical drawings to scale - Multiple colorways, print; embellishment details - Basic Graded Specs - Point of measurement diagrams - Bill of Materials - Brand; Care Labels, Folding instructions, Tags I'm eager to discuss the specific design and application of this head covering with you. A zoom meeting or call can be arranged to go over the details. ...

    €84 Average bid
    €84 Gns Bud
    23 bud

    ...Legislation. The project involves setting up and customizing Odoo's payroll functionalities to manage our workforce effectively and in accordance with local labor laws. Scope of Work: Odoo Payroll Configuration: Install and set up the Odoo Payroll module. Customize salary structures and rules to align with Mauritius labor laws, including: Minimum wage requirements. Overtime, weekend, and public holiday pay rates. Leave entitlements and deductions. Ensure accurate tax computations and statutory deductions as per Mauritius regulations. Time Clock Integration: Implement and configure Odoo's Attendance module for precise tracking of employee working hours. Define working schedules, shifts, and break periods in line with company policies and legal requirements. In...

    €152 Average bid
    €152 Gns Bud
    11 bud

    I'm seeking a professional to improve both the aesthetic design and functionality of a flower bouquet box. Key Areas of Focus: - Functionality: The box needs to be easier to transport. - Aesthetic Design: Improvements in colors and patterns are sought. Ideal Skills and Experience: - Product Design: Proven experience in designing functional and aesthetically pleasing products. - Understanding of Transport Logistics: Able to design with transport efficiency in mind. - Graphic Design: Skills in creating appealing color and pattern designs.

    €84 Average bid
    €84 Gns Bud
    55 bud

    Top bill of materials Community-artikler