Bidding projects data entry freshers hyderabadJobs
html5 css khjjfd dlkfldkf d lkdlfkd fdfdlkf dfkdlfkdlkf k;jglfh bvlfhbl fl;bh lhvks vk vhsvhls vl slgs;g;s
89888765goldenbirds5646546465hgvtftfyddddrddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd
Programiranje za SQL i Android: molim vas vaš kontakt da se čujemo na telefon xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
a dialer for my asterisk box kasdjlasjdlasjdlasjdlasjdalsdjalsdjalskjdalskjdalskjdalksjdalskjdalskjdlksajdlasjdalsjdalsjdalsjdalsjalskjd 100chars
Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all
Data Entry for dangersystem_S_Coords_2_90373362_dangersystem_First_1500 Data Entry for dangersystem_S_Coords_2_90373362_dangersystem_First_1500
Data Entry for bd100m_S_Coords_3_57638273_bd100m…t1500 Data Entry for bd100m_S_Coords_3_57638273_bd100m…t1500
hi, i just need somebody for a few hours working for my project, if i like it i have more work. beste regards. Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugi...
...to work with you Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugiat a, tellus. Phasellus viverra nulla ut metus varius laoreet. Quisque rutrum. Aenean imperd...
SharePoint 2013 Responsive Design Html 5 For government internet site SharePoint 2013 Responsive Design Html 5 For government internet site
edit a songxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ddssvdddddfhfhdhjsakhdsakjhdsakhdjsköahdaskjhdsajhdsajkhdaksjhdsöhjdkajshdyaCDFUIVGHEFUBHVEUKRHBIOWUVYGWOIQUFWIVNGUQEHRPIUAFUHBIERUHHAEFEFVJHHJKFEHQFHRB BHIRRULGR
!!!!!!!!!!gjhggyug gujgjhguyfujgjhg yguyguyuuyg gjyguyg guyghgiug giuyghjbg ohugo giuygh ouighy oygo gougogo gougogyg gyugoig ogoy gyogog ogyb
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad ...
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
Data harvesting affdd gsfg hsdh sdgh hgh gjhh djdj h hdfjfd fj dfjhj jjf dgjddfdfd aas sf f aff adfd af df fdf fad f
i want install ngenx mod ..........................................................................................................................................
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
fsdfsdddddddderterterrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddddddddddddddddddddddddddd
Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TO RECEIVE THE PROJECTS, GO TO MY COMPANIES INSTAGRAM at enamorarseapparel... ONLY THE BEST WILL GET HIRED!
NEED programmer ......................................................................00000000000000000000000000000000000000000000000000
jeanpierrejesses09 skype add me thanks xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
data entry dsaadsdasd sdaddf dsf f fds fds fdsf dsfds dsf fd fds dsf dfs fds dfs fsd sdf sdf f s fdsf fds f
I need customer information from PDFs entered into my Shopify store, as well as product descriptions. Tasks Include: - Entering customer information from PDFs into Shopify - Inputting 51-100 product descriptions, which include text with tables Ideal Skills: - Proficiency in Shopify - Attention to detail - Data entry experience - Able to interpret and input text with tables accurately
I need a skilled data entry operator to help extract data from text documents. Key Responsibilities: - Extracting data from various text documents sourced from web pages. Ideal Skills: - Proficient in data extraction techniques. - Experienced in working with text documents. - Familiar with navigating and extracting data from web pages. Please note, experience with web data extraction is highly preferred.
I'm seeking a skilled data entry professional to assist with cleaning and formatting my Excel spreadsheets. The primary task will be identifying and removing duplicates from the data sets. Ideal Skills: - Proficiency in Excel - Attention to detail - Experience in data cleaning and formatting Please bid only if you can deliver quality work promptly. Thank you!
I'm seeking a skilled 3D artist to create a semi-realistic, anime-styled figurine for display on my shelf. I have specific reference images that will guide the design, so the ability to interpret and adapt these references is key. Ideal Skills: - Proficiency in 3D modeling software (e.g., Blender, Maya, ZBrush) - Experience with character design, specifically in the anime style - Strong ...have specific reference images that will guide the design, so the ability to interpret and adapt these references is key. Ideal Skills: - Proficiency in 3D modeling software (e.g., Blender, Maya, ZBrush) - Experience with character design, specifically in the anime style - Strong attention to detail and ability to follow reference images closely Please include a portfolio of relevant work when ...
I'm looking for a proficient Claris FileMaker developer who can assist with current integrations, primarily focusing on order processing. The task entails automating order entry and integrating various systems to streamline this process. Key Responsibilities: - Enhancing our order processing system - Automating order entry in collaboration with customer Warehouse Management Systems and ERP Systems - Supporting existing Claris FileMaker integrations with customers Ideal Skills: - Extensive experience with Claris FileMaker - Proficiency in PHP and/or C++ - Prior working experience in the logistics industry
I am looking for an experienced real estate agent or freelancer with expertise in the Shadnagar, Hyderabad area to assist me with selling my land. As I live outside India, I need someone reliable and resourceful to handle the entire process on my behalf. Key Responsibilities: 1. Facilitate the sale of my land by finding potential buyers and negotiating deals. 2. Generate a new/duplicate copy of the original sale deed, as the current one is tampered. 3. This will involve working with the local Sub-Registrar office and completing any required legal formalities. 4. Provide regular updates on progress and maintain clear communication throughout the process. Requirements: 1. Proven experience in real estate transactions in Shadnagar or nearby regions. 2. Familiarity with the process ...
I'm seeking a reliable virtual assistant to help with email management and data entry tasks. Key Responsibilities: - Email Management: Primarily Customer Support. Your role will involve handling customer inquiries via email, ensuring timely and professional responses. - Data Entry: This will mainly involve updating spreadsheets and potentially managing our CRM. Ideal Skills: - Excellent written communication skills for customer correspondence. - Proficiency in data entry and familiarity with spreadsheet management. - Experience with CRM systems is a plus. - Ability to maintain confidentiality and handle sensitive information with discretion.
I'm seeking a skilled developer to create an automation bot for me. This bot's main task will be handling data entry and processing. It should be capable of: - Integrating with various web applications - Efficiently gathering and processing text data Ideal candidates should have: - Extensive experience in bot development, particularly for data entry and processing tasks - Proficiency in integrating bots with web applications - A strong understanding of handling and processing text data -Write "Bot Developer" on the first line of your bid proposal to avoid auto-bid The ability to automate these tasks will significantly enhance my productivity and efficiency.
...Zoom Calls or AnyDesk. Important Note: To all freelancers applying: We strongly recommend bidding the actual price for the project rather than using low bids as a tactic to initiate a chat. Those bidding £20-30 initially, only to later reveal and confirm a significantly higher rate ( 10 times higher in most cases ), will be removed from consideration and may be banned from future opportunities with us. The advert has more than enough info, therefore makes no sense to ask again for the same info/details or ask another million more questions just to realise that most info was already on the advert initially. We strongly advise you to read the advert properly before wasting your time bidding for something that you might not be able to do. Let’s...
I need an experienced developer to set up my Discord server with bots that will manage user permissions based on their Stripe subscriptions. Key Requirements: - The bots should automatically kick users when their subscription expires, remo...subscriptions. Key Requirements: - The bots should automatically kick users when their subscription expires, removing all permissions immediately. - Subscribers should have access to exclusive channels and the ability to (post images only in the community entry channel) - Non-subscribers should lose all privileges upon expiration without warning. Ideal Skills: - Proficiency in Discord bot development. - Experience with Stripe API integration. - Understanding of Discord server management. Please provide examples of similar projects ...
...other centralized exchanges (CEXs) to provide users with a robust platform for trading cryptocurrencies. The terminal should offer real-time data, order execution capabilities, portfolio management features, and a monetization strategy through fee structures. Objectives To create an intuitive and user-friendly trading terminal. To ensure seamless integration with the Binance API and other CEXs for liquidity. To implement security best practices to protect user data and transactions. To establish a fee structure for monetizing the platform. Key Features 1. User Interface (UI) Dashboard: A comprehensive dashboard displaying real-time market data, including price charts, order books, and recent trades. Order Management: Functionality for placing, modifying, an...
I'm looking for an experienced Virtual Assistant to support my disability and NDIS-related business in Australia. This role involves handling various tasks such as admin work, data entry, invoicing, and managing my Xero account. If you have marketing expertise, that's a big plus. Key Responsibilities: - Admin tasks & data entry - Invoicing management via Xero - Marketing strategies and implementation (if applicable) Ideal Skills & Experience: - Proficient in admin work & data entry - Experience with Xero bookkeeping software (essential!) - Good grasp of marketing strategies (preferred) - High attention to detail and excellent communication skills This is an ongoing role, paid hourly at $10 AUD per hour.
I'm looking for a skilled graphic designer to create a modern-style logo for my company. The logo should incorporate an icon and text, using a color palette of blue, black, and white. Key Requirements: - Proficient in graphic design software (Adobe Illustrator, Photoshop, etc.) - Experience in logo design, particularl...Proficient in graphic design software (Adobe Illustrator, Photoshop, etc.) - Experience in logo design, particularly modern and abstract styles - Ability to create a compelling icon and text combination - Excellent understanding of color harmony and design aesthetics - Good communication skills for understanding and implementing feedback Please provide a portfolio of your previous logo designs when bidding. I'm looking for a quick turnaround without comp...
I'm looking for a Django expert to help migrate my small site from the old Django version (1.54, under Python 2.6.9) to the latest (Django 5.5). The site has both custom code and third-party libraries. Here's what you need to know: - **Site Migration**: The primary objective is to ensure the site runs smoothly on the new Django version without altering the user interface design....thoroughly testing the site post-migration. Ideal candidates will have: - Extensive experience with Django and Python - Proven track record of similar migrations - Strong problem-solving skills - Ability to conduct manual testing and ensure site functionality I will have ssh/web access to the old server and the new server. They are hosting at AWS Please provide examples of previous similar projec...
I'm seeking an entry-level Google Ads Farmer for my IGaming company in the Philippines. The role encompasses a variety of responsibilities, including: What You’ll Be Doing: - Registering Google accounts (following detailed instructions). - Performing specific actions on accounts (watching videos, visiting websites). - Launching advertising campaigns in Google Ads (using templates). - Monitoring ad performance after launch. - Writing ad copy (headlines, descriptions, keywords). What We Offer: - Paid trial week – $100 (separately). - Salary: $400 for the first 3 months, then $500. - We provide all materials: instructions, SIM cards, VPNs, etc. Requirements: - Strict adherence to instructions. - Attention to detail and discipline. - Quick...
I'm looking for an experienced developer to create a Prestashop module that integrates with the Trendyol Marketplace API. The module should support product listing, inventory management , message management and order synchronization. Key Features: - Product Listi...include: - Proficient in Prestashop module development - Experience with Trendyol Marketplace API - Knowledge in multi-language and currency support in e-commerce platforms - Strong understanding of inventory management systems Freelancers with a track record in developing similar modules and understanding of the Trendyol ecosystem will be prioritized. Please provide a portfolio of relevant projects when bidding. Pls find the documentation below
I've got a 2002 MS Access application that needs to be upgraded to the current MS Access version. The app is primarily used for data entry and management, and the upgraded version will need to support multiple users with different permissions. Key Requirements: - Upgrade from 2002 MS Access to the latest version - Retain all original functionalities without enhancements - Support for multiple users with different permissions Ideal Skills: - Extensive experience with MS Access - Strong understanding of data management applications - Ability to replicate complex permission structures in new software - Knowledge of MS Access security features for user permissions
I'm looking for an expert in Excel to help me create a special spreadsheet that will collect and organize vital customer information. This project will involve detailed manual data entry. Key Requirements: - Collecting customer contact details (name, phone, email) and purchase history. - Organizing this data in an efficient and easy to understand manner in Excel. Ideal Skills: - Proficiency in Microsoft Excel. - Excellent attention to detail for data accuracy. - Experience with data entry and data organization. - Good understanding of customer data and purchase history. Please note, the data will need to be entered manually, so patience and diligence are essential for this task.
