The Hidden Benefits of Freelancing: How it Can Enhance Your Future Career Opportunities
The Hidden Benefits of Freelancing: How it Can Enhance Your Future Career Opportunities
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
Hi erinkennedy, plz help me understand freelancing
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
Aqui está a tradução para o inglês: Título: The Kingdom of Dancing Stars In a distant planet, beyond the clouds, existed a magical kingdom called Estrelaria. This place shimmered with stars day and night, and its inhabitants lived in harmony with celestial light. Personagens (Characters) 1. *Luna*: An 8-year-old curious and dreamy girl with silver hair and starry eyes. 2. *Estrelinha*: A mischievous, winged creature with butterfly wings and radiant hair. 3. *King Sol*: The majestic ruler of Estrelaria, with fiery hair and solar eyes. A História (The Story) Luna, living on Estrelaria's outskirts, loved hearing star stories and dreamed of flying among them. One day, she found lost Estrelinha, who spoke of the endang...
I'm in need of two realistic digital portraits of the historical figures 'Cyaxares' and 'Nabopalassar.' The portraits should be in a style similar to that of the "History Explained" YouTube channel, which features impressive custom portraits of historical figures. I will attach screenshots from that channel of what I would want my two figures to look like. So to be clear, they would look similar to these screenshots, but still unique in their own ways. In the attached image depicting 3 kings, the one on the far right is Nebuchadnezzar. The character I want comissioned, 'Nabopalassar,' is his father. So I hope that would help in creating someone similar to what is attached. Key Requirements: - The style of...
I'm seeking an expert to analyze the impact of Gaussian measurement noise on the accuracy of estimating parameters from a second order equivalent circuit model. The primary focus will be on estimating resistance and capacitance. Key components of the project: - Assess the influence of Gaussian noise on model parameter estimation. - Explore the efficacy of the Kalman filter in mitigating the effects of this noise. Ideal candidates will have: - Strong background in circuit modeling. - Proficiency in noise analysis and filtering techniques, especially the Kalman filter. - Experience with parameter estimation of circuit components.
My IT company is looking for a dedicated professional to manage 3000 business leads per month. We already have the leads. The key tasks include cold calling, email marketing, and social media outreach, with a ...IT assessments, which our team will convert into paying contracts if a need is identified. Key Responsibilities: - Prioritize cold calls to generate business leads. - Engage in email marketing and social media outreach. - Promote the benefits of our free IT assessment during calls. Requirements: - Excellent communication and interpersonal skills. - Experience in cold calling and lead generation, preferably in IT. - Ability to work independently and think on your feet during calls. - Familiarity with email marketing and social media outreach. - Understanding of...
...few people get.. But.. Also, you get all of the following INCLUDED with NO HIDDEN COST in a YEARLY price of 129 USD: ➡️ Be among the elite few to earn the new IFC badge on your profile so that you can stand out! (Upon successful completion of the test) - Priceless! ➡️ Unlock hours of groundbreaking video content I’ve been working on for months that's nowhere else to be found. (399 USD, INCLUDED!) ➡️ Numerous attachments with client conversation pipelines, strategies, tools and much more! (199 USD, INCLUDED!) ➡️ Dive into biweekly live streams with the masters, ask anything you want, and pick up secrets they don't just share with anyone. (100 USD per hour, INCLUDED!) ➡️ An overview with my thoughts of all newsletters I'm subsc...
More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Detailed project proposals How soon do you need your project completed? Within a month
Important : Kindly bid if and only if you are willing to take a test assignment. We are looking for a skilled and experienced Figma designer to convert 20 pages of JPG website designs into a fully responsive Figma project. The designs need to be pixel-perfect and optimized for Desktop, Mobile, and Tablet screen sizes. Project Requirements: 1. Figma Expertise: • Convert 20 JPG design files into Figma accurately, maintaining pixel-perfect alignment with the original designs. 2. Responsive Design: • Create layouts optimized for Desktop, Tablet, and Mobile views. • Ensure the designs are fully responsive and adaptable to different screen sizes. 3. Consistency: • Use Figma’s components, auto-layouts, and styles to maintain consistency across the project...
I'm in need of a high-precision 3D scan of a small plastic object, roughly 2 inches or less. The primary purpose of this scan is for 3D printing, so the model needs to be as accurate as possible. Ideal Skills: - Proficient in 3D scanning technology - Experience in creating models for 3D printing - Attention to detail for high-precision tasks
Hello dear readers, I am a full-time professional trader, having started my journey about five years ago. During this time, I’ve experienced both the pitfalls of scams and the benefits of working with genuine people who truly want to help others succeed. Now, five years later, I am a consistently profitable trader, and I’ve gained a deep understanding of how the markets move and how to profit from them. My portfolio generates an average annual return of around 500%, with a strong focus on risk management. My goal is to attract investors who are interested in copying my trades and linking their accounts to my trading portfolio. However, my main challenge lies in attracting and finding investors, as marketing is not my strong suit. So, my q...
I'm in need of a dedicated and creative individual to manage my beauty blog for 30 days. The primary focus will be on daily product reviews of various makeup products. Key Responsibilities: - Generate and post fresh content and imagery daily for a month. - Conduct in-depth reviews of makeup products, focusing on their ingredients and benefits, user testimonials, and comparisons with similar products. Ideal Skills and Experience: - Prior experience in beauty blogging or product reviewing is highly preferred. - Strong understanding and passion for makeup products. - Excellent writing skills with a knack for creating engaging and insightful content. - Ability to create appealing and relevant imagery. - Experience in comparing products and articulating insig...
Seeking a skilled social media marketer to increase exposure and sales for 'My Daily Choice,' a brand specializing in natural weight loss products, including sprays and supplement pills. The project will involve: - Developing and implementing a marketing strategy tailored to adults aged 25+. - Creating engaging content that highlights the benefits of our all-natural products. - Managing and optimizing our social media presence to maximize reach to the target demographic. - Utilizing analytics tools to monitor performance and adjust strategies as needed.
You have a pre-built java vaadin saas platform? I'm looking for an experienced developer who can work with a pre-built Java Vaadin SaaS platform. The key tasks will involve extending the platform to meet our specific requirements, as well as incorporating our branding g...pre-built java vaadin saas platform? I'm looking for an experienced developer who can work with a pre-built Java Vaadin SaaS platform. The key tasks will involve extending the platform to meet our specific requirements, as well as incorporating our branding guidelines into the design. Ideal Skills: - Proficiency in Java and Vaadin - Experience with SaaS platform development - Strong understanding of UI/UX, with the ability to adapt to branding guidelines - Prior experience with platform customization a...
This project delves into the fascinating intersection of behavioral finance and data science. We aim to analyze ptivided data through the lens of investor psychology, identifying behavioral biases and sentiment drivers that influence market trends. Using R and statistical modeling, we will examine historical market data, news sentiment, and social media trends to develop predictive models of market movements. This project offers a unique opportunity to contribute to a cutting-edge research initiative with real-world applications in investment strategy and risk management. Key Deliverables: Quantitative analysis of market data and investor behavior. Development of predictive models incorporating behavioral finance insights. Comprehensive report with data...
I'm seeking a minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and...minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and vivid, so it should pop and be visually engaging. Key Requirements: - Animation should have a minimalist design - Use of a bright and vivid color palette - Customization of the poker chips with my provided logo in the middle area Ideal Skills and Experience: - Proficient in creating WebM animations - Strong understanding of minimalist design principles - Experience with logo and patte...
My Digital Ocean droplet, which hosts a web application, has stopped responding after a restart. I suspect a network issue. It’s crucial to get this fixed ASAP. Ideal Skills: - Experience with Digital Ocean droplets - Networking troubleshooting - Web application hosting - Server management Please reach out if you can assist. Bid if you can start working immediately
I am in the process of developing a custom HR system and my freelancer needs my assistance regarding tax regulations. I am looking for someone with expertise in both Australian and Philippine tax laws. Key Requirements: - Extensive knowledge of Employee income tax, Corporate tax, and GST/VAT in both Australia and the Philippines. - Ability to integrate tax calculations into various components of the HR system including Payroll processing, Employee benefits, and Expense reimbursements. - Previous experience working with HR systems is a plus. Your expertise will ensure that the HR system is compliant with both countries' tax regulations. Please include in your bid an outline of your experience with tax consulting and HR systems.
...AI-based early detection of congenital heart defects (CHDs) using a 12,000-labeled echocardiogram dataset. I need an experienced freelancer to completely build and train models using Convolutional Neural Networks (CNNs) and Generative Adversarial Networks (GANs) to achieve accurate and reliable results. The task involves: Preprocessing: Augmentation and cleaning of the dataset. Model Development: Building and training a GAN-CNN hybrid model for CHD detection. Validation: Testing and validating the model to generate results, including metrics like accuracy, sensitivity, and specificity. Deliverables: Fully functional code (Python/TensorFlow/Keras, Google Colab preferred). Final results and visualizations (accuracy metrics, confusion matrix, etc.). Proper documentation ...
I am seeking a talented creative writer with a knack for crafting captivating romance narratives. Your primary task will be to create engaging storylines that resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narrati...resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narratives. - Ability to understand and cater to an adult audience. Your creative storytelling will not only entertain but also draw readers into the beautiful complexities of...
I am in need of a talented copywriter who can help me craft compelling product descriptions aimed at increasing sales. The target audience for these descriptions is the general consumer market, so the copy will need to be accessible, engaging, and persuasive to a wide array of potential customers. Ideal Skills and Experience: - Proven experience in copywriting, particularly in crafting product descriptions - Strong understanding of sales-oriented copy - Ability to write for a general consumer audience - Creativity and ability to think outside the box - Excellent command of the English language
I need a professional 3D Blender expert who can bake an entire house for me. I have existing 3D models of the house, so there's no need to create new ones from scratch. Key requirements: - 3D baking of the house's entire structure: exterior walls, roof, and interior rooms - Applying low-detail, basic textures to the models Ideal skills and experience: - Proficiency in 3D Blender - Previous experience in 3D modelling and texture baking - Attention to detail while applying basic textures
I'm looking for a professional video editor based in the USA to edit 25 promotional videos monthly for my client. Each video is under 1 minute in length, and the editing style should be clean and professional. Details: - Monthly Requirement: 25 videos - Payment: $25 per video - Freelancing: Allowed - Editing Style: Clean and professional, suitable for promotional content. Reference and raw clip
I'm looking for a creative and inno...creative and innovative designer to craft a promotional brochure for a product aimed at teachers and professors. The brochure should effectively communicate the product's features and benefits in a style that's both engaging and professional. Key Responsibilities: - Design a brochure that is visually appealing and aligns with an innovative and creative style. - Understand and target the content towards teachers and professors. - Use a formal yet approachable tone to convey the product's value. Ideal Skills: - Experience in designing promotional materials, particularly for the education sector. - Strong understanding of visual design principles and creative thinking. - Excellent communication skills to understand proj...
...Specialist to join our team in finalizing animated film projects. ? Here is the example of the animation that we prefer: . Video length: 5-10minutes. Frequency: 6-7 videos/week. Target: 25 years old and older. You will be responsible for editing visuals, adding special effects, synchronizing audio, and ensuring the final product meets the highest quality standards. Requirements: - Proficiency in post-production software such as Adobe Premiere, After Effects, or equivalents. - Experience in video editing, visual effects, and sound editing. - Creative mindset, attention to detail, and strong teamwork skills. - Time management skills and ability to meet project deadlines. Benefits: - Attractive salary and bonus in a creative work environment. - Opportunity to participate
...looking for a professional writer with experience in PR and a strong understanding of the Indian news landscape. The task is to write 5 high-quality articles focused on product information for publication on Indian news websites. These articles will be used for Facebook business verification, so they need to be credible, engaging and reach a wide audience. Key Requirements: - Excellent English writing skills with a knack for creating engaging content - Proven experience in writing PR articles - Strong understanding of product-oriented storytelling - Familiarity with the Indian news landscape - Ability to write for the general public The articles should be informative, highlighting key features and benefits of our product in a way that is accessible and appe...
The Hidden Benefits of Freelancing: How it Can Enhance Your Future Career Opportunities
Want to launch your freelancing side-gig and earn some extra income? Learn how to in just 10 days.
Freelancing offers flexibility, independence, and growth, but comes with challenges like managing income and work responsibilities.