Average hourly cost of software developerJobs
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
Jeg tilbyder professionelle tekster og korrektur af høj kvalitet. Jeg skriver levende, flydende og fejlfrit. Både til web og print. Som cand. merc. med kommunikation som speciale har jeg mere end 8 års erfaring med at kommunikere til forskellige målgrupper, bl.a. som redaktør på blade og web samt med at lave foldere, nyhedsbreve, undervisningsmateriale, sprogrevision på interne/eksterne tekster, pressemeddelelser og artikler. Jeg er uddannet korrekturlæser og har fuldstændig styr på grammatik og kommaregler. Jeg har blandt meget andet skrevet web-tekster, bagsidetekster til bogudgivelser, nyhedsbreve, været redaktør på personaleblad, været skribent og gæsteblogger, korrekturlæst og red...
Vi leder efter en som kan udvikle/designe en App, der både virker til IOSx, Android m.v. Der skal også udvikles en Component som skal virke i Joomla 2.5 -
Jeg vil gerne have lavet en bot som kan kører i alle web browsers. Botten er slags ranking bot til en spil som hedder: Hvad skal botten kunne gøre? - Lave alle 3 crimes (crime, stjæle en bil, og lave indbrud i et hus Vælge nr 2 ud af de 9 mulige. ) - Bypass Captcha via
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Upgrade algorithms for HighIQPro desktop.
Hej Vi har i dag to programmer, vi sælger til vores kunder. Programmerne er lavet til at udskrive tekst og billeder på labels i forskellige størrelser. Vi vil gerne have lavet et software, som er en kombination af de to vi bruger i dag. Så softwaren i vedhæftet filer
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
Skal bruge en programmør som kan lave et stykke software som håndterer betalinger via landingpages og sender bruger informationerne til vores database, samt laver en afmeld knap. Mere fortælles når opgaven accepteres.
Project Overview: We are seeking a skilled and experienced blog writer or team of writers to rewrite 4000 existing articles from a source website. The goal is to create 4000 entirely new, unique, and plagiarism-free articles for publication on our website. The rewritten content must maintain the original meaning and factual accuracy of the source material while sounding natural, engaging, and human-written. We want to avoid any robotic or AI-generated tone. Project Scope: Content Volume: 4000 articles Source Material: Provided in CSV format (containing article titles and content). Deliverables: 4000 rewritten articles in a specified format (e.g., .docx, .txt, or directly into a WordPress staging environment – to be discussed). Content Requirements: Uniqueness: 100% o...
I'm looking for a skilled Flutter developer with extensive experience in healthcare applications and seamless data transfer. The project involves developing a wearable device aimed at tracking productivity and performance, specifically focusing on mental acuity. Key Responsibilities: - Design and develop a wearable device that tracks cognitive function, attention span, and stress levels. - Ensure seamless data transfer and integration with the app. Ideal Skills and Experience: - Proficiency in Flutter and BLE (Bluetooth Low Energy) technology. - Proven experience in developing healthcare applications. - Understanding of mental focus tracking and related metrics. - Excellent problem-solving and communication skills.
I need to find someone with experience as a successful tiktok developer to help me sign up for tiktok developer account.
I need a professional to install a new Cortinovis make Rigid Strander Machine with 54 bobbins and 630mm specifications in my industrial factory. All necessary utility connections are already in place.
Investment Tracking • Expense Categorization: • Allow input of expenses (e.g., raw materials, labor, electricity) under predefined or custom categories. • Link expenses to specific production batches or departments. • Batch-Wise Cost Tracking: • Allocate costs to production batches and track total investment for each. • Maintain logs for historical comparison and analysis. • Real-Time Updates: • Automatically update total costs as data is entered or tasks progress. Production Workflow Management • Workflow Automation: • Define production stages: Raw Material Procurement → Cutting → Stitching → Designing → Quality Check → Packaging. • Track status for each stage (e.g., “In Progres...
...leading manufacturer of overhead conductors, specifically HTLS type, ACSR, AAC, AAAC and Copper Contact wires, seeking an experienced freelancer to drive our business development efforts in US, compensation to be success based. Responsibilities: 1- Market Research: Identify customers, clients for ACSR & HTLS conductors across US. 2- Business Strategy: Develop and implement strategic business plans. 3- Lead Generation: Actively seek and qualify leads, converting them into business opportunities. 4- Reporting: Provide regular updates on progress, market insights, and competitive analysis. Requirements: 1- Experience: Proven track record of sales to Distributors, Utilities, Wholesalers of electrical equipment to Transmission & Distribution. 2- Knowledge: Stro...
Job Title: Android Developer Experience: 2+ Years Location: Remote or On-site Job Description: We are seeking a skilled Android Developer to join our team. The ideal candidate will be responsible for maintaining existing codebases and developing new features and applications from scratch. Responsibilities: Maintain, debug, and enhance existing Android applications. Design and develop new Android applications and features. Collaborate with cross-functional teams to define, design, and ship new functionalities. Ensure the best possible performance, quality, and responsiveness of applications. Stay updated with the latest trends and best practices in Android development. Requirements: Proven experience of 2+ years in Android development. Strong knowledge of...
I'm in need of an automation specialist familiar with Selenium, Zapier or Make.com. The task involves pushing and pulling most LIVE sales data from into my Knack app. The idea is to completely remove the need to use eBay's seller hub website for finding information. We also use ebay to purchase items and need to have that data imported into the app. Purpose of Data: The primary purpose of this data transfer is for customer service/sales tracking, automate purchase order information, and move the following information to knack: Order statuses of our customers orders returns cancellations cases or requests new purchases(we're the buyer) customer shipping tracking numbers(we're the seller) purchase shipping tracking numbers(we're the buy...
We are looking for a skilled developer/team to build our mobile application, BHUDEVI, that serves as a comprehensive platform for farmers. The app should include: - AI-Powered Features: *AI-based plant scanner to detect crop diseases and provide solutions. *Data-driven insights for farmers, analyzing weather, soil health, crop conditions, and market trends for personalized recommendations. - User Accessibility: *Multilingual support with regional languages for farmers across India.(Kannada, English, Telugu) *Offline mode functionality for areas with limited connectivity. *Easy-to-use interface for farmers with minimal technical knowledge. - Expected Deliverables: *A fully functional Android and iOS app. *Backend setup with cloud-based infrastructure. *Documentation and training...
I'm seeking an experienced developer specialized in creating 2D pixel art fighting games for PC and Console. Key Requirements: - Expertise in developing 2D fighters, specifically using pixel art for the game's visuals. - Strong knowledge in cross-platform compatibility for PC and Console. - Ability to create engaging and balanced gameplay mechanics typical of fighting games. Ideal Skills: - Proficiency in game development engines, particularly ones supporting 2D and pixel art (e.g. Unity, Godot). - Previous experience with developing fighting games is highly preferred. - Strong understanding of pixel art aesthetics and ability to implement them in a game development context. Below, I attached gameplay footage made with M.U.G.E.N. to showcase what I want t...
I'm looking for a professional who can bring my black and white photo to life with realistic colorization. The goal is to make the colorization as natural as possible, without any specific colors for particular elements in the photo. Key Requirements: - Expertise in photo editing and colorization - Ability to follow provided reference images - Atte...the colorization as natural as possible, without any specific colors for particular elements in the photo. Key Requirements: - Expertise in photo editing and colorization - Ability to follow provided reference images - Attention to detail - Creative thinking I will provide the reference images to guide the colorization process. Your task will be to use these images to create a colorized version of the photo that looks as realist...
I'm looking for an Angular expert to help me develop a Progress...basis. The ideal candidate should have extensive experience with Angular and PWA development, and be capable of implementing the core features of this project, which include: - Offline capabilities: The application should be able to function without internet connectivity, caching resources and enabling users to access content offline. - Push notifications: I want to incorporate real-time updates and alerts to engage users and enhance their experience. - Responsive design: The application should provide a seamless experience across all devices, from desktops to smartphones. If you have a strong portfolio of Angular and PWA projects, and can deliver high-quality, efficient work on an hourly b...
...devices (desktop, mobile, and tablet) • Be up to date with the latest features of webflow and web development tech. Qualifications: • Skills: • Solid grasp of HTML, CSS, and basic JavaScript. • Experience using tools like Webflow. • Familiarity with responsive design principles and cross-browser compatibility. • Familiarity with UI, interaction, animation design principles. • Proficiency in design tools such as Figma. • Basic understanding of version control systems (e.g., Git). • Additional Skills: • Strong problem-solving and analytical skills. • Excellent attention to detail and commitment to quality. • Ability to work independently and collaboratively in a fast-paced environment. • Passion for sta...
Here’s a refined list of bullet points incorporating your working projects: General Project Requirements: Clear Project Scope: Define and document detailed requirements for deliverables specific to each project module. Timeline and Milestones: Establish clear deadlines and milestones for each phase of the project across all applications. Budget Allocation: Ensure cost estimations for testing tools and resource requirements are aligned with the project budget. Collaboration: Maintain regular communication with developers, designers, and stakeholders for effective project progress. Resource Planning: Utilize tools and frameworks to test web and mobile applications effectively, including device management for mobile testing. For Testing Your Projects: 1. Swarajya W...
I need a freelancer skilled in graphic design and vectorization to convert a photograph into a full color, realistic vector image suitable for shirt printing. Key Requirements: - Transform a photograph into a realistic vector image - Full color vectorization - Experience with preparing designs for shirt printing Ideal Skills: - Proficiency in Adobe Illustrator or similar vector graphic software - Strong attention to detail - Prior experience in apparel graphic design
I’m looking for a skilled and creative Marketing & Branding Specialist (individual applicants only—NO AGENCIES) to take charge of pre-launch marketing for a social media app. Your role will be pivotal in building brand awareness, generating organic traffic, and ensuring a successful launch. Key Responsibilities: - Craft and execute a tailored pre-launch marketing strategy. - Set up and manage social media accounts (X/Twitter, Instagram, Facebook, etc.) with engaging campaigns. - Generate buzz and drive user sign-ups to the app’s website. - Launch cost-effective digital marketing campaigns with measurable results. - Update and optimize the app’s website (built on Framer) to align with branding and marketing goals. - Leverage marketing ...
I'm looking for a mlm Software development professional web developer to create a custom-built, web-based Product booking site named "RapidBooking". The primary feature of this site should be a advance booking system that allows users to book cars instantly. Key Features: - A comprehensive, interactive, and user-friendly advance booking system. - Payment gateway integration for seamless transactions. Ideal Skills: mlm Software development - Extensive experience in custom-built website development. - Proficiency in creating and managing real-time systems. - Strong understanding and experience in payment gateway integration. - Excellent skills in user interface (UI) and user experience (UX) design. Please only apply if you have a proven track ...
I need a desktop-based software for an ESP32 development module educational kit. This software should allow users to write code, compile and upload it to the module. It should support different sensors and provide a user-friendly Graphical User Interface (GUI). Key Requirements: - Code writing in Scratch, C and Python - Compilation and uploading to the ESP32 module - Interaction with various sensors - Intuitive GUI - Compatibility with Windows and MacOS Ideal Skills: - Proficient in software development for educational purposes - Experience with ESP32 and various sensors - Skilled in creating GUI software - Knowledgeable in Scratch, C and Python - Able to ensure cross-platform compatibility (Windows and MacOS)
Part Time Freelance Developer Needed for MVP Development of a Marketplace Platform Location Preference: Jaipur (Remote candidates with strong portfolios will also be considered). About the Project: We are building an MVP for a marketplace platform designed to connect service providers and users. The platform will feature user-friendly booking functionality, provider management tools, and integrated payment systems. The goal is to create a seamless and scalable web application with a clean interface and efficient backend. We are looking for a skilled freelance developer to develop this MVP from the ground up. You will be collaborating with our team to create a polished, functional product within a specified timeframe. Scope of Work Core Features:...
I'm looking for an experienced professional to assist my company with creating invoices online.
I need a skilled translator to convert approximately 3000 words of English marketing content into Hebrew. - Content Context: The material is intended for the general public, so the translation should be easily understandable, without the use of overly complex terminology or industry jargon. - Tone: The translation should convey a casual tone, mirroring the style of the original English content. It should be engaging, friendly, and approachable, appealing to a wide audience.
We are seeking a skilled Software Developer with expertise in Python and Node.js to join our team on a project basis. The ideal candidate will be responsible for troubleshooting and resolving issues in our existing applications hosted on a Digital Ocean server. **Responsibilities:** - Analyze and troubleshoot existing Python code and Node.js applications to identify issues and improve performance. - Implement fixes and enhancements to ensure optimal operation and security of applications. - Collaborate with the development team to discuss issues, propose solutions, and deploy fixes. - Manage deployments and updates on a Digital Ocean server environment. - Document all work performed, including code changes and troubleshooting steps. - Provide regular updates on progre...
...want is a quote. This isnt the final product. This is just a quick 3d file, a basic form, to gauge if I want to go ahead. Its a bootleg 3rd party robot toy, if their machining quote is too high I wont make it so if your file cost is outrageous Im probably not going to pick you. Very basic form: head, torso, legs all one part then arms seperate. You could use any pre-made set you already have! Just a few tweaks neaded for arm plugs...and it needs sizing specs. Key Requirements: - Proficiency in CAD software - Experience in designing for stretch blow moulding - Knowledge of .stl file creation for 3D printing - Familiarity with blow moulding process -Toy design, arm plugs. Please note that the specific material for the blow moulding has not yet been decided, so the...
I'm seeking a proficient Flutter developer to assist with the installation of a fully developed staff tracking app. This project involves publishing the app on both iOS and Android platforms. Key Responsibilities: - Minor customizations and configurations before the app's publication - Optimization of the app to meet both iOS and Android store guidelines and requirements Ideal Candidate: - Extensive experience with Flutter development - Proven track record of publishing apps on iOS and Android - Strong understanding of store guidelines and requirements - Ability to implement minor changes as per requirements - Excellent troubleshooting and problem-solving skills
I'm looking for an Excel expert who can create a dynamic data visualization tab for analyzing financial data specifically for ROI metrics. The main focus will be on cost savings and investment returns. Key Requirements: - Use of Charts and Graphs: I need clear and engaging visual representations of the data. - Pivot Tables: Help in summarizing the data and making the analysis more manageable. - Conditional Formatting: To highlight key trends and important information in the data. Ideal Skills: - Advanced Excel: Proficiency in using Excel's more complex features. - Financial Analysis: Understanding of financial data and metrics. - Data Visualization: Ability to present data in a clear and engaging way. Please only bid if you can deliver a high-quali...
I am looking to create a Virtual Developer Assistant, an AI-powered system that acts like a full-time developer. This assistant should be capable of: Building complete systems and applications based on user inputs (e.g., backend, frontend, databases). Modifying existing systems to adapt them to new requirements. Developing complete applications for web and mobile platforms. Deploying systems automatically to platforms like Heroku, Vercel, or custom servers. The AI assistant must function like a professional employee, capable of handling coding tasks autonomously. The user should only provide high-level instructions, and the assistant should deliver complete, functional systems. Key Requirements: AI Features: Use of OpenAI models (e.g., Codex, GPT) for ...
Description: We are looking for a reliable and experienced contractor in Brisbane who can assist with the following tasks for a modular expansion home: Foundation Construction: Constructing concrete pillar foundations for the modular home. Home Installation: Installing the expansion home on the concrete foundation, including unfolding and setting it up. Additional Work: Installing ...a partner who can manage the full installation process from start to finish. Please provide your experience, availability, and a quote for the work required. Required Skills: Foundation construction (concrete pillars) Modular home installation Crane and trailer operation Deck and shade canopy installation Interior cabinetry installation Please send your proposal with an estimated timeline and cost f...
I'm looking for 2 attractive, professional banners to promote our company to nonprofits and to businesses. Banners should incorporate our logo and convey the message of: 1. Residual fundraising from savings and rebates from supporters' everyday shopping. 2. Retailers can partner withthe community to get new, Loyal Customers With Zero upfront cost. look through our website... and The ideal candidate for this project should have: - Graphic design experience, particularly with banner design - An understanding of nonprofit messaging - Ability to create a balance between a professional and welcoming tone - Match our branding Banners will primarily be used on our website, social media, newsletters and local events. The successful freelancer
I'm looking for a skilled WordPress developer with demonstrated experience in Elementor Plugin and Elementor full features, HTML, and CSS. The primary purpose of the site will be to promote my business, with a heavy emphasis on showcasing images and galleries. Key Responsibilities: - Develop and design a WordPress site using Elementor Theme. - Optimize the site for business promotion. - Create a visually appealing gallery-focused content layout. Ideal Skills: - Proficient in WordPress, Elementor Theme, HTML, and CSS - Strong design sense, particularly for image and gallery presentation - Previous experience with business promotion websites I want the site to have a blog section featuring content, with possibilities for a comment section, social media sharing, and news...
I need an Excel spreadsheet to monitor the billed hours of each of our automotive technicians, as well as their total team hours each day. This tracking should be in relation to the daily goals we've set for them. This website gives some example of what I'm after Key Features: - A bar chart graphic display to visualize the data (along with actual numbers) - Tracking for individual technician hours and combined team hours - Comparison of hours worked against daily goals for individual as well as team -The graphic should represent how close to the set goal they are. Below 80% is red, 80-99.9% is yellow and 100% and up is green. Our automotive technicians are paid a bonus based their actual billed hours vs their target goal for billed hours. Also as...
I'm in need of a minimalist and modern website to showcase my Chatbot. The site will utilize a registered domain and include a pitch video. The successful applicant will embed Gradio onto the webpage and implement load balancing and a timeout page. The ideal candidate for this project should have: - A proven track record in Chatbot/LLM development with a strong portfolio. - Prior experience working with Gradio and ideally with Modal. - A collaborative spirit and a reasonable hourly rate. Optional tasks, based on your professional experience, may include: - Promoting the website using GoDaddy tools. - Proposing other relevant activities to enhance the site. The project timeframe is between 14 to 20 days.
I'm looking for a skilled Python developer with experience in building web-based content management systems (CMS). This project involves creating a CMS with specific features and functionalities tailored to our needs. Key Project Requirements: - Develop a robust, user-friendly web application with Python. - Implement a comprehensive content management system. - Incorporate essential features such as user roles and permissions to manage access and control content. Ideal Skills and Experience: - Proficient in Python with a strong portfolio of web applications. - Prior experience in developing content management systems is a plus. - Understanding and expertise in implementing user roles and permissions.
I need help configuring Windows on my PC and setting up various gaming software. Key Requirements: - Initial Windows setup and installation. - Software configuration, primarily for gaming. - Troubleshooting software bugs and conflicts. Ideal Skills: - Proficiency in Windows installation and configuration. - Experience with gaming software setup. - Strong troubleshooting skills for software issues.
We are looking to hire an experienced OpenAI developer to help us build a custom content writing tool that will tailor its outputs to the specific writing styles of multiple clients. This tool will use OpenAI's language models (such as GPT-4) to generate content that is in line with the unique writing preferences and tone of each client. The goal is to create a system where, before generating content, users can select a client, and the tool will adjust its writing approach based on predefined client-specific parameters stored in a database. In addition, the tool should be able to learn and adapt its writing style over time by analyzing submitted content, allowing it to better understand and mimic each client’s voice. Since this is my first time using AI te...
I'm seeking a skilled Flutter developer to join our team for ongoing work on the Groom mobile app. Your role will involve not only enhancing the app with new features, but also optimizing performance and troubleshooting issues as they arise. If awarded, my GIT, my cPanel will need to be updated daily until MVP with Admin panel is fully live. MVP APK: Landing Pages: Key Responsibilities: - Collaborate with our development team - Develop new features and functionalities - Optimize app performance and resolve bugs - Write clean, maintainable code - Stay current with Flutter's latest technologies - Prepare and maintain technical documentation for new features and functionalities
I'm in need of a professional software application developer who can create a robust business tool to streamline my inventory management processes. Key Requirements: - Software Development: Proficient in creating software applications, with a focus on business tools. - Inventory Management: Understands the intricacies of inventory management to ensure the software meets all necessary requirements. - User-friendly Interface: Able to design a software application that is easy to use for all levels of tech-savviness. - Reliable Support: Offers post-launch support for any troubleshooting or updates needed. Your expertise in these areas will be crucial for the success of this project. Looking forward to your proposals...
I need a skilled Excel professional to update my spreadsheet. The updates involve enhancing the existing formulas and functions, as well as improving the design and formatting. The base document...2025-2035 Key Requirements: - Expertise with Excel functions and formulas - Strong skills in design and formatting Please note, the specific functions and formulas that need to be implemented have not yet been determined. However, you should be comfortable using lookup functions (like VLOOKUP, HLOOKUP), statistical functions (like AVERAGE, MEDIAN), and logical functions (like IF, AND, OR). Your ability to understand and manipulate data will be crucial to the success of this project. Ideal Skills: - Advanced Excel skills - Experience with data analysis - Strong design and format...
...screen, reviewing various aspects of the site. Key Topics to Cover: 1. Content Management 2. Performance Optimization (Focus on Page Load Speed) 3. SEO (Emphasis on Keyword Optimization) 4. Plugin and Theme Maintenance 5. Security Check 6. Navigation and Usability 7. Analytics and Insights 8. Backup and Export 9. User and Subscriber Management 10. Design and Branding 11. Legal and Compliance 12. Customer Engagement The ideal freelancer should have a deep understanding of , excellent SEO skills particularly in keyword optimization, and a strong background in performance optimization. Experience with analysing page load speed and implementing necessary improvements is crucial. Please note that this may require more than one session, billed at an hourly rate. The...