Applications of sensors in everyday lifeJobs
...product/service introduction. Requirements: - The purpose of the video explainer is to introduce my product/service to potential customers. - I do not have an existing script or narrative, but I have a rough idea of what I want to convey. - The video length required is 1 minute. Ideal Skills and Experience: - Strong scriptwriting skills to create a compelling and engaging script. - Experience in creating video explainers for product/service introductions. - Proficiency in video editing and animation software to bring the script to life. - Creativity and ability to turn rough ideas into a visually appealing and informative video. If you have the skills and experience required, please submit your proposal with examples of your previous work ...
The creation of a virtual office
We are looking for freelancer who can develop at least 15 videos everyday for 30-45 days i.e 450-675 videos per month.
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Note: Only applications from Scandinavia please. Jeg søger en udvikler der enten kan "renovere" og forny vores 14 år gamle jobsite kodet i klassisk asp eller kode et helt nyt site fra bunden og evt. brug af et CMS eller framework. Det nuværende site er kodet fra bunden og har en lang række avancerede features og dermed relativt høj kompleksitet. Sitet drives på fritidsbasis, men har potentiale og en stor brugerbase hvorfor der også skal kodes en nyt premium annonce facilitet som skal sikre indtægter ligesom tanken er at udbrede sitet med flere sprogversioner udover dansk. Af samme årsag kan jeg ikke betale de høje timetakster som bureauerne tager, men en lavere takst som er angivet her. For den re...
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
Jeg skal have klonet min livsstils-app "Way of Life - The Ultimate Habit Maker & Breaker" () til Android. Mange af de designmæssige spørgsmål er således afklaret og jeg skal derfor primært bruge en udvikler som hurtigt kan se hvordan den eksisterende app kan udvikles til Android. Hver platform har dog sine "måder" at gøre tingene på, så derfor må du også gerne have forstand på hvordan en måde at gøre tingene på i iOS, måske bør gøres anderledes på Android for at få den rigtig Android-feeling. De overordnede linjer er dog lagt. Way of Life gør flittig brug af SQLite (gennem Core Data) og det forventes at...
Objectives The project in this semester is an interdisciplinary project. It combines distributed systems design, computer science and computer networks. PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each tr...
Objectives The project in this semester is an interdisciplinary project. It combines distributed systems design, computer science and computer networks. PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each tr...
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm in need of an expert in PHP Laravel who is also proficient in TypeScript and JavaScript. The ideal candidate will have experience in developing complex web applications and building RESTful APIs. Key project requirements include: - Developing a complex web application with user authentication, real-time notifications, and payment gateway integration. - Building RESTful APIs for the application. Key skills required: - Deep understanding of PHP Laravel - Proficiency in TypeScript and JavaScript - Experience in developing complex web applications - Expertise in building RESTful APIs - Knowledge in implementing user authentication, real-time notifications, and payment gateway integration.
...to create a unique golf social networking app with an integrated gambling twist. Social Networking Features: - The primary function of the app is to connect golfers. It should be location-oriented, enabling players to find and interact with other users in their vicinity. - Users should be able to post pictures and comments about their rounds/matches on a forum. - A filter system for user profiles is essential. Users should be able to filter other players by profession, handicap, age, and country club. Gambling Features: - Players will deposit money into the app akin to a legalized sports betting platform. - The app should facilitate the organization of matches against other users, with the ability to wager and determine the match style. - A "match play le...
...showcase the two characters effortlessly dispatching a group of animals representing other memecoins in the market. Key Details for the Animation: Length: 30 seconds Style: 2D animation (modern, fun, and lively) Characters: Louie Lambo: A confident green gecko wearing a sharp suit, sunglasses, and a glowing XRP championship belt. Panda: Louie’s cool, calm, and collected sidekick. Antagonists (other memecoins): A group of animals surrounding Louie and Panda, representing rival memecoins. Photos of these animals will be provided. Scenes to Animate: Opening Scene: Louie and the Panda are walking down the street, counting their money, looking relaxed and confident as they represent the best in the memecoin space. The Threat Emerges: A group of...
I need a custom-built Windows remote desktop access application. This app should be capable of: - Facilitating file transfer - Supporting multi-monitor setups - Enabling clipboard synchronization - Allowing screen sharing and control - Handling printer redirection The application should authenticate users through a simple username and password system. Please note that this project does not require advanced security measures like Two-factor authentication or SSO. Ideal candidates for this project should have a strong background in software development with a focus on remote desktop applications. Experience working with Windows systems is a must, and familiarity with the specified features will be a significant advantage. I'm looking for a freelancer who can deli...
I'm seeking an experienced Swift developer with ARKit expertise to create an iOS AR application. This app will identify public landmarks via the camera and display relevant information as text overlays on the ...text overlays on the screen. Key Features: - Detecting public landmarks through the camera. - Displaying information such as the store name, logo, and details about departments and places. - Utilizing ARKit to present the information seamlessly. Ideal Candidate: - Proficient in Swift with a strong portfolio of iOS applications. - Extensive experience with ARKit and augmented reality app development. - Ability to create interactive and user-friendly interfaces. - Understanding of how to implement real-time data overlay in an AR environment. ...
I'm in need of a talented and experienced app developer with a strong background in healthcare applications. The project involves creating desktop and mobile apps compatible with both iOS and Android platforms. Key Features: - Appointment Booking System: The app should facilitate easy scheduling of appointments. - Patient Records Management: A secure and efficient system for managing patient records is crucial. - In-app Messaging: The app should include a secure and user-friendly messaging system for communication between patients and healthcare providers. Security Requirements: Given the sensitive nature of healthcare data, the applications must incorporate high-level security features: - Data Encryption: All data transmitted...
I'm seeking a skilled MERN stack developer to create a straightforward Point of Sale (POS) system to build a functional and user-friendly application. The project requires implementing key features including user authentication, product management, inventory tracking, sales processing, and basic reporting/analytics. The ideal candidate should demonstrate proficiency in the MERN stack, RESTful API development, state management (Redux/Context API), responsive design, and version control systems. Essential technical skills include expertise in MongoDB for database management, for backend routing, React.js for dynamic frontend interfaces, and Node.js for server-side logic. The developer will be responsible for creating an intuitive POS system with smooth user experie...
...integration of a 'Nem Tilmeld' page into WordPress. Our association, Foreningen Mennesker Mødes, is a volunteer-driven organization aimed at preventing loneliness, promoting health, and insisting on living life to the fullest. We are based in Esbjerg and our website is www-mm-e.dk. As we are a non-profit organization with a modest annual membership fee of kr. 100,00, we hope to find someone who understands our situation and can offer their services at a reasonable price. Specific Tasks: - Review and improve the homepage of our WordPress site - Assist in setting up a new MailPoet mailing list - Help with the integration of a 'Nem Tilmeld' page into WordPress Ideal Skills: - Proficient in WordPress - Exp...
I'm looking ...memoir. The book should be written in a compelling first-person narrative style. - The primary focus of my memoir revolves my unique life experiences. - The tone of the memoir should be reflective and humorous, capturing the ups and downs of my journey with a light-hearted yet insightful perspective. - I want to highlight specific themes throughout the memoir, including family relationships, cultural identity, and politics. Ideal Skills: - Exceptional writing and storytelling abilities - Experience in ghostwriting, particularly memoirs - Ability to capture and convey personal experiences - Strong understanding of first-person narrative style - Excellent communication skills to liaise and understand my experiences and...
I'm looking for a skilled web developer with PHP expertise to bring my e-commerce website design to life. The project involves implementing several key features that are crucial for a seamless shopping experience. Key Responsibilities: - Translate the provided design into a fully functional e-commerce site - Implement a secure and reliable payment gateway - Develop a user account creation and management system - Create a comprehensive and intuitive product search and filter functionality Ideal Candidate: The ideal freelancer for this project should have extensive experience in PHP and e-commerce website development. A keen eye for detail is essential to accurately reflect the provided design. Experience with implementing payment gateways and user management systems is ...
I'm looking for a talented animator to bring my logo to life with 2D animation featuring my mascot character (Louie the cat) interacting with a public domain one (Mickey Mouse). PLEASE SEE ATTACHED FILE: "" for general look desired (final product will need to be more polished). I do not want that "Corporate 2D Flash Animation" look. Key Requirements: - 2D Animation: The logo should be animated in a smooth, professional 2D style. - Character Movement: I want my mascot character, Louie, to move within the animation along with Mickey Mouse. Essentially, the cat eats the mouse, then transitions into the logo. - Mascot Integration: The animation should seamlessly incorporate my mascot character into the logo.
...play a critical role in the talent acquisition process by sourcing, screening, and qualifying candidates for various positions within our company. You will work closely with hiring managers to understand their needs, identify potential candidates, and ensure a smooth and efficient hiring process. Your goal is to build a strong pipeline of qualified candidates and help us hire the best talent for our team. Key Responsibilities: Candidate Sourcing: Utilize various channels, including job boards, social media, professional networks, and direct outreach, to identify and engage potential candidates. Screening: Conduct initial phone screenings and interviews to assess candidates' qualifications, experience, and cultural fit. Candidate Qualification: Review resumes and ...
I need a mobile app tester to test an APK on a real Android device. The focus will be on functional testing, which means checking all features work as expected. The ideal candidate should have experience in testing mobile applications and should be able to provide detailed feedback on the app's functionality. Please ensure you have a real Android device for this task.
Job Title: Creative Video Editor & Content Visionary for TES (Travel, Entertainment, Style) IG: @tes_ratings Project Details • Duration: Ongoing (initial trial period of 1 week to test quality). • Budget: Open to bids. Please provide: • Weekly rate for 3-6 video edits. • Breakdown of additional costs, if any. Overview: TES is a growing review platform aiming to become a household name for travelers and everyday individuals. We deliver engaging reviews in the Travel, Entertainment, and Style categories. To achieve this, we need a skilled freelancer who can bring our content to life weekly through compelling videos while maintaining our established branding. What We’re Looking For A Video Editor & Visionary to: 1...
I'm kicking off a small business focusing on minimalist design-themed fridge magnets, stickers, button pins, tote bags, key chains, etc. I'd love to collaborate with a talented graphic designer to h...button pins, tote bags, key chains, etc. I'd love to collaborate with a talented graphic designer to help create designs for printing. Initially, I need designs for stickers, specifically with an Islamic theme. Key requirements: - Proficiency in minimalist design - Experience in product design for small merchandise - Familiarity and understanding of Islamic themes and motifs - Strong portfolio of sticker design - Skill in creating designs suitable for printing Your task will be to collaborate with me to understand my vision and bring it to...
I'm looking for a creative writer to help me bring entertainment to life for the youngest audience. I'm working on a children's book that's catered for the 0-4 age group. The main goal of this book is to entertain and make children smile, so I need a writer who can craft stories that are both engaging and age-appropriate. Key points: - Target audience: 0-4 years old - Goal: To entertain and engage - Proven experience in children's book writing - Ability to create imaginative and engaging content Your writing should be colorful, simple, and imaginative. I need someone who can capture the essence of childhood and make it an enjoyable read for both kids and parents. If you have experience in this field and are passionate about c...
...menopause support and everyday nutrition. While our product is still in production, we want to build buzz and create a community before our launch. What We Need We’re looking for a part-time Marketing Manager who can develop and own the marketing strategy while also executing the day-to-day tasks. This is a hands-off role where you’ll have the freedom to propose and implement ideas, experiment, and adjust as needed to deliver results. While we’ll provide high-level guidance and collaborate during weekly or bi-weekly check-ins, the responsibility for delivering on the strategy will rest with you. Please see details of the job post here with all the details: Please ensure details of the Job requirements
I'm looking for a freelancer to create a stylised, cartoonish, digital drawing of three pugs and a German shepherd. The final piece will be intended for framing. Ideal Skills & Experience: - Proficient in digital illustration - Strong understanding of cartoonish drawing style - Experience creating pet portraits - Able to deliver high-quality, print-ready artwork
I'm seeking assistance with integrating my larger web application with Firebase. The project involves primarily working with JavaScript (JS and JSX) files, and to a lesser extent, HTML files. Tasks: - Setting up the Firebase project and authentication process - Uploading ...application with Firebase. The project involves primarily working with JavaScript (JS and JSX) files, and to a lesser extent, HTML files. Tasks: - Setting up the Firebase project and authentication process - Uploading and hosting the necessary files - Configuring the database and storage rules Ideal candidates for this project should have a strong background in JavaScript, with considerable experience in handling larger web applications. Proficiency in Firebase setup, file hosting, an...
...to better cater to our African client base, with a primary focus on: - Document storage and retrieval - Workflow automation - Permission management The DMS should be affordable and designed with ease of use as the most critical aspect. The successful freelancer will have experience in developing user-friendly web-based applications. A deep understanding of document management systems and their core functionalities is essential. Key Requirements: - Proven experience in DMS development - Excellent skills in creating web-based interfaces - Strong focus on ease of use in design - Understanding of localization for African markets - Ability to build an affordable yet robust system Your proposal should demonstrate your relevant...
